Psyllid ID: psy518


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-
MTTVISPSVELSSYRDQHFKGSRAEQEKLLRTTSTLYVGNLSYYTTEEQLYELFSKCGDIKRIIMGLDKYKKTPCGFCFLE
ccccccccccccccccccccccHHHHHHHHccccEEEEEcccccccHHHHHHHHHccccccEEEEEccccccccccEEEEc
ccccccccHcccccccccccccHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHccEEEEEEEEccccccEEEEEEEE
mttvispsvelssyrdqhfkgsRAEQEKLLRTTSTlyvgnlsyyTTEEQLYELFSKCGDIKRIIMGldkykktpcgfcfle
mttvispsvelssyrdqhfkgsraeqekllrttstlyvgnLSYYTTEEQLYELFSKCGDIKRIIMGLDKYKKTPCGFCFLE
MTTVISPSVELSSYRDQHFKGSRAEQEKLLRTTSTLYVGNLSYYTTEEQLYELFSKCGDIKRIIMGLDKYKKTPCGFCFLE
****************************LLRTTSTLYVGNLSYYTTEEQLYELFSKCGDIKRIIMGLDKYKKTPCGFCFL*
***********************************LYVGNLSYYTTEEQLYELFSKCGDIKRIIMGLDKYKKTPCGFCFLE
********VELSSYRDQHFKGSRAEQEKLLRTTSTLYVGNLSYYTTEEQLYELFSKCGDIKRIIMGLDKYKKTPCGFCFLE
*******S*ELSSYRDQHFKGSRAEQEKLLRTTSTLYVGNLSYYTTEEQLYELFSKCGDIKRIIMGLDKYKKTPCGFCFLE
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTVISPSVELSSYRDQHFKGSRAEQEKLLRTTSTLYVGNLSYYTTEEQLYELFSKCGDIKRIIMGLDKYKKTPCGFCFLE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query81 2.2.26 [Sep-21-2011]
Q177H0159 Nuclear cap-binding prote N/A N/A 1.0 0.509 0.790 4e-35
B0W939160 Nuclear cap-binding prote N/A N/A 1.0 0.506 0.777 7e-35
Q7QCB6163 Nuclear cap-binding prote yes N/A 1.0 0.496 0.777 3e-34
Q1HE01154 Nuclear cap-binding prote N/A N/A 0.950 0.5 0.779 4e-33
B4KCD5154 Nuclear cap-binding prote N/A N/A 0.950 0.5 0.766 3e-32
B3P0D7154 Nuclear cap-binding prote N/A N/A 0.950 0.5 0.779 6e-32
B7P877152 Nuclear cap-binding prote N/A N/A 0.913 0.486 0.783 6e-32
B4PL68154 Nuclear cap-binding prote N/A N/A 0.950 0.5 0.779 6e-32
B3LYP1154 Nuclear cap-binding prote N/A N/A 0.950 0.5 0.766 6e-32
B4JUT1154 Nuclear cap-binding prote N/A N/A 0.950 0.5 0.753 1e-31
>sp|Q177H0|NCBP2_AEDAE Nuclear cap-binding protein subunit 2 OS=Aedes aegypti GN=Cbp20 PE=3 SV=1 Back     alignment and function desciption
 Score =  146 bits (368), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 76/81 (93%)

Query: 1  MTTVISPSVELSSYRDQHFKGSRAEQEKLLRTTSTLYVGNLSYYTTEEQLYELFSKCGDI 60
          MT+V +PSV LS YRDQHFKGSR EQE+LLR TSTLY+GNLS+YTTEEQ++ELFS+CGDI
Sbjct: 1  MTSVHTPSVALSKYRDQHFKGSRHEQERLLRLTSTLYIGNLSFYTTEEQIHELFSRCGDI 60

Query: 61 KRIIMGLDKYKKTPCGFCFLE 81
          +RI+MGLDK+KKTPCGFCF+E
Sbjct: 61 RRIVMGLDKFKKTPCGFCFVE 81




Component of the cap-binding complex (CBC), which binds co-transcriptionally to the 5' cap of pre-mRNAs and is involved in various processes such as pre-mRNA splicing and RNA-mediated gene silencing (RNAi). The CBC complex is involved in miRNA-mediated RNA interference and is required for primary microRNAs (miRNAs) processing. Also involved in innate immunity via the short interfering RNAs (siRNAs) processing machinery by restricting the viral RNA production. In the CBC complex, Cbp20 recognizes and binds capped RNAs (m7GpppG-capped RNA) but requires Cbp80 to stabilize the movement of its N-terminal loop and lock the CBC into a high affinity cap-binding state with the cap structure.
Aedes aegypti (taxid: 7159)
>sp|B0W939|NCBP2_CULQU Nuclear cap-binding protein subunit 2 OS=Culex quinquefasciatus GN=Cbp20 PE=3 SV=1 Back     alignment and function description
>sp|Q7QCB6|NCBP2_ANOGA Nuclear cap-binding protein subunit 2 OS=Anopheles gambiae GN=Cbp20 PE=3 SV=3 Back     alignment and function description
>sp|Q1HE01|NCBP2_BOMMO Nuclear cap-binding protein subunit 2 OS=Bombyx mori PE=2 SV=1 Back     alignment and function description
>sp|B4KCD5|NCBP2_DROMO Nuclear cap-binding protein subunit 2 OS=Drosophila mojavensis GN=Cbp20 PE=3 SV=1 Back     alignment and function description
>sp|B3P0D7|NCBP2_DROER Nuclear cap-binding protein subunit 2 OS=Drosophila erecta GN=Cbp20 PE=3 SV=1 Back     alignment and function description
>sp|B7P877|NCBP2_IXOSC Nuclear cap-binding protein subunit 2 OS=Ixodes scapularis GN=Cbp20 PE=3 SV=1 Back     alignment and function description
>sp|B4PL68|NCBP2_DROYA Nuclear cap-binding protein subunit 2 OS=Drosophila yakuba GN=Cbp20 PE=3 SV=1 Back     alignment and function description
>sp|B3LYP1|NCBP2_DROAN Nuclear cap-binding protein subunit 2 OS=Drosophila ananassae GN=Cbp20 PE=3 SV=1 Back     alignment and function description
>sp|B4JUT1|NCBP2_DROGR Nuclear cap-binding protein subunit 2 OS=Drosophila grimshawi GN=Cbp20 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query81
156542829158 PREDICTED: nuclear cap-binding protein s 0.975 0.5 0.860 5e-35
270006915161 hypothetical protein TcasGA2_TC013348 [T 1.0 0.503 0.814 6e-35
189237587 182 PREDICTED: similar to Cbp20 [Tribolium c 1.0 0.445 0.814 7e-35
307197645165 Nuclear cap-binding protein subunit 2 [H 0.938 0.460 0.881 9e-35
332030010165 Nuclear cap-binding protein subunit 2 [A 1.0 0.490 0.827 2e-34
380016916166 PREDICTED: nuclear cap-binding protein s 0.938 0.457 0.881 3e-34
48142250166 PREDICTED: nuclear cap-binding protein s 0.938 0.457 0.881 3e-34
340712465166 PREDICTED: nuclear cap-binding protein s 0.938 0.457 0.881 4e-34
242022257170 Nuclear cap-binding protein subunit, put 0.987 0.470 0.812 7e-34
322789715165 hypothetical protein SINV_03383 [Solenop 1.0 0.490 0.827 9e-34
>gi|156542829|ref|XP_001608109.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  151 bits (381), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 76/79 (96%)

Query: 3  TVISPSVELSSYRDQHFKGSRAEQEKLLRTTSTLYVGNLSYYTTEEQLYELFSKCGDIKR 62
           + SPSVELSSYRDQHFKGSRAEQ++LLR ++TLYVGNLS+YTTEEQ+YELFSKCGDIKR
Sbjct: 2  NINSPSVELSSYRDQHFKGSRAEQDRLLRNSTTLYVGNLSFYTTEEQIYELFSKCGDIKR 61

Query: 63 IIMGLDKYKKTPCGFCFLE 81
          IIMGLDKYKKTPCGFCF+E
Sbjct: 62 IIMGLDKYKKTPCGFCFME 80




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270006915|gb|EFA03363.1| hypothetical protein TcasGA2_TC013348 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189237587|ref|XP_975066.2| PREDICTED: similar to Cbp20 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307197645|gb|EFN78824.1| Nuclear cap-binding protein subunit 2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332030010|gb|EGI69835.1| Nuclear cap-binding protein subunit 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|380016916|ref|XP_003692414.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Apis florea] Back     alignment and taxonomy information
>gi|48142250|ref|XP_397316.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|340712465|ref|XP_003394780.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Bombus terrestris] gi|350399792|ref|XP_003485640.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|242022257|ref|XP_002431557.1| Nuclear cap-binding protein subunit, putative [Pediculus humanus corporis] gi|212516860|gb|EEB18819.1| Nuclear cap-binding protein subunit, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|322789715|gb|EFZ14881.1| hypothetical protein SINV_03383 [Solenopsis invicta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query81
FB|FBgn0022943154 Cbp20 "cap binding protein 20" 0.913 0.480 0.797 3.8e-30
UNIPROTKB|B5G279168 NCBP2 "Nuclear cap-binding pro 0.888 0.428 0.777 3.9e-28
ZFIN|ZDB-GENE-020419-31155 ncbp2 "nuclear cap binding pro 1.0 0.522 0.695 5e-28
UNIPROTKB|Q5ZKR5168 NCBP2 "Nuclear cap-binding pro 0.888 0.428 0.763 6.4e-28
UNIPROTKB|C0H859155 ncbp2 "Nuclear cap-binding pro 1.0 0.522 0.707 1e-27
UNIPROTKB|C1BY64155 ncbp2 "Nuclear cap-binding pro 0.901 0.470 0.767 1e-27
UNIPROTKB|Q3ZBJ1156 NCBP2 "Nuclear cap-binding pro 0.901 0.467 0.780 1.3e-27
UNIPROTKB|E2RFC9156 NCBP2 "Uncharacterized protein 0.901 0.467 0.780 1.3e-27
UNIPROTKB|P52298156 NCBP2 "Nuclear cap-binding pro 0.901 0.467 0.780 1.3e-27
UNIPROTKB|F2Z5Q9156 NCBP2 "Uncharacterized protein 0.901 0.467 0.780 1.3e-27
FB|FBgn0022943 Cbp20 "cap binding protein 20" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 333 (122.3 bits), Expect = 3.8e-30, P = 3.8e-30
 Identities = 59/74 (79%), Positives = 70/74 (94%)

Query:     8 SVELSSYRDQHFKGSRAEQEKLLRTTSTLYVGNLSYYTTEEQLYELFSKCGDIKRIIMGL 67
             SVELSSYRDQHFKGSR+EQE+ LR + TLYVGNLS+YTTEEQ++ELFS+CGD++ I+MGL
Sbjct:     4 SVELSSYRDQHFKGSRSEQERSLRDSCTLYVGNLSFYTTEEQIHELFSRCGDVRVIVMGL 63

Query:    68 DKYKKTPCGFCFLE 81
             DKYKKTPCGFCF+E
Sbjct:    64 DKYKKTPCGFCFVE 77




GO:0000339 "RNA cap binding" evidence=ISS
GO:0005846 "nuclear cap binding complex" evidence=ISS
GO:0003729 "mRNA binding" evidence=ISS
GO:0005681 "spliceosomal complex" evidence=ISS
GO:0005634 "nucleus" evidence=ISS
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC;ISS
GO:0000166 "nucleotide binding" evidence=IEA
GO:0045292 "mRNA cis splicing, via spliceosome" evidence=IEA
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0071011 "precatalytic spliceosome" evidence=IDA
GO:0071013 "catalytic step 2 spliceosome" evidence=IDA
GO:0045071 "negative regulation of viral genome replication" evidence=IMP
GO:0035195 "gene silencing by miRNA" evidence=IMP
GO:0030422 "production of siRNA involved in RNA interference" evidence=IMP
UNIPROTKB|B5G279 NCBP2 "Nuclear cap-binding protein subunit 2" [Taeniopygia guttata (taxid:59729)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-020419-31 ncbp2 "nuclear cap binding protein subunit 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZKR5 NCBP2 "Nuclear cap-binding protein subunit 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|C0H859 ncbp2 "Nuclear cap-binding protein subunit 2" [Salmo salar (taxid:8030)] Back     alignment and assigned GO terms
UNIPROTKB|C1BY64 ncbp2 "Nuclear cap-binding protein subunit 2" [Esox lucius (taxid:8010)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZBJ1 NCBP2 "Nuclear cap-binding protein subunit 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RFC9 NCBP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P52298 NCBP2 "Nuclear cap-binding protein subunit 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5Q9 NCBP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B1WC40NCBP2_RATNo assigned EC number0.78080.90120.4679yesN/A
B5G279NCBP2_TAEGUNo assigned EC number0.77770.88880.4285yesN/A
Q9V3L6NCBP2_DROMENo assigned EC number0.78660.92590.4870yesN/A
P52298NCBP2_HUMANNo assigned EC number0.78080.90120.4679yesN/A
Q9P383NCBP2_SCHPONo assigned EC number0.67300.64190.2857yesN/A
Q3ZBJ1NCBP2_BOVINNo assigned EC number0.78080.90120.4679yesN/A
Q93594NCBP2_CAEELNo assigned EC number0.62020.96290.4936yesN/A
Q7QCB6NCBP2_ANOGANo assigned EC number0.77771.00.4969yesN/A
Q6DES0NCBP2_XENTRNo assigned EC number0.72600.90120.4771yesN/A
Q9CQ49NCBP2_MOUSENo assigned EC number0.78080.90120.4679yesN/A
Q08920NCBP2_YEASTNo assigned EC number0.79160.59250.2307yesN/A
Q54KR9NCBP2_DICDINo assigned EC number0.75470.65430.2264yesN/A
Q9XFD1NCBP2_ARATHNo assigned EC number0.5750.98760.3112yesN/A
Q84L14NCBP2_ORYSJNo assigned EC number0.56250.98760.3292yesN/A
Q8JGR6NCBP2_DANRENo assigned EC number0.69511.00.5225yesN/A
Q754W7NCBP2_ASHGONo assigned EC number0.75510.60490.2247yesN/A
Q5ZKR5NCBP2_CHICKNo assigned EC number0.76380.88880.4285yesN/A
Q293V6NCBP2_DROPSNo assigned EC number0.75320.95060.5yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query81
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 2e-33
smart0036073 smart00360, RRM, RNA recognition motif 3e-16
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 1e-12
pfam0007670 pfam00076, RRM_1, RNA recognition motif 3e-12
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 6e-12
COG0724 306 COG0724, COG0724, RNA-binding proteins (RRM domain 8e-11
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 2e-10
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 2e-09
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 7e-09
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 8e-09
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 8e-09
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 1e-08
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 3e-08
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 3e-08
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 5e-08
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 5e-08
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 7e-08
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 7e-08
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 9e-08
cd1255076 cd12550, RRM_II_PABPN1, RNA recognition motif in t 9e-08
cd1255177 cd12551, RRM_II_PABPN1L, RNA recognition motif in 1e-07
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 2e-07
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 2e-07
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 3e-07
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 3e-07
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 6e-07
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 6e-07
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 6e-07
cd1224579 cd12245, RRM_scw1_like, RNA recognition motif in y 7e-07
cd1226085 cd12260, RRM2_SREK1, RNA recognition motif 2 in sp 8e-07
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 8e-07
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 1e-06
cd1231772 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition mot 2e-06
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 2e-06
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 2e-06
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 2e-06
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 5e-06
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 6e-06
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 6e-06
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 1e-05
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 1e-05
cd1261574 cd12615, RRM1_TIA1, RNA recognition motif 1 in nuc 1e-05
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 1e-05
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 2e-05
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 3e-05
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 4e-05
cd1237276 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif 4e-05
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 4e-05
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 4e-05
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 4e-05
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 5e-05
cd1262274 cd12622, RRM3_PUB1, RNA recognition motif 3 in yea 6e-05
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 8e-05
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 8e-05
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 8e-05
cd1259972 cd12599, RRM1_SF2_plant_like, RNA recognition moti 9e-05
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 9e-05
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 1e-04
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 1e-04
cd1275977 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA 1e-04
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 1e-04
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 1e-04
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 1e-04
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 2e-04
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 2e-04
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 2e-04
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 2e-04
cd1258575 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in h 2e-04
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 3e-04
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 3e-04
TIGR01642 509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 3e-04
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 3e-04
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 4e-04
cd1225976 cd12259, RRM_SRSF11_SREK1, RNA recognition motif i 4e-04
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 4e-04
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 4e-04
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 4e-04
cd1261681 cd12616, RRM1_TIAR, RNA recognition motif 1 in nuc 5e-04
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 5e-04
cd1240477 cd12404, RRM2_NCL, RNA recognition motif 2 in vert 6e-04
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 6e-04
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 6e-04
cd1228192 cd12281, RRM1_TatSF1_like, RNA recognition motif 1 7e-04
cd1259375 cd12593, RRM_RBM11, RNA recognition motif in verte 7e-04
cd1259275 cd12592, RRM_RBM7, RNA recognition motif in verteb 7e-04
cd1233872 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 8e-04
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 9e-04
cd1227172 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Ar 0.001
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 0.001
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 0.001
cd1228081 cd12280, RRM_FET, RNA recognition motif in the FET 0.001
cd1239491 cd12394, RRM1_RBM34, RNA recognition motif 1 in RN 0.001
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 0.001
cd1264377 cd12643, RRM_CFIm68, RNA recognition motif of pre- 0.001
cd1256872 cd12568, RRM3_MRD1, RNA recognition motif 3 in yea 0.002
cd1268075 cd12680, RRM_THOC4, RNA recognition motif in THO c 0.002
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 0.002
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 0.002
cd1267079 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 0.002
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 0.002
cd1258871 cd12588, RRM1_p54nrb, RNA recognition motif 1 in v 0.002
cd1222884 cd12228, RRM_ENOX, RNA recognition motif (RRM) in 0.002
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 0.003
cd1240572 cd12405, RRM3_NCL, RNA recognition motif 3 in vert 0.003
cd1233380 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 0.003
TIGR01659 346 TIGR01659, sex-lethal, sex-lethal family splicing 0.003
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 0.003
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 0.003
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 0.003
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 0.003
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 0.004
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 0.004
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 0.004
cd1276076 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA 0.004
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
 Score =  109 bits (275), Expect = 2e-33
 Identities = 39/46 (84%), Positives = 45/46 (97%)

Query: 36 LYVGNLSYYTTEEQLYELFSKCGDIKRIIMGLDKYKKTPCGFCFLE 81
          LYVGNLS+YTTEEQ+YELFS+CGDIKRIIMGLD++ KTPCGFCF+E
Sbjct: 1  LYVGNLSFYTTEEQIYELFSRCGDIKRIIMGLDRFTKTPCGFCFVE 46


This subfamily corresponds to the RRM of CBP20, also termed nuclear cap-binding protein subunit 2 (NCBP2), or cell proliferation-inducing gene 55 protein, or NCBP-interacting protein 1 (NIP1). CBP20 is the small subunit of the nuclear cap binding complex (CBC), which is a conserved eukaryotic heterodimeric protein complex binding to 5'-capped polymerase II transcripts and plays a central role in the maturation of pre-mRNA and uracil-rich small nuclear RNA (U snRNA). CBP20 is most likely responsible for the binding of capped RNA. It contains an RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain), and interacts with the second and third domains of CBP80, the large subunit of CBC. . Length = 78

>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240994 cd12550, RRM_II_PABPN1, RNA recognition motif in type II polyadenylate-binding protein 2 (PABP-2) and similar proteins Back     alignment and domain information
>gnl|CDD|240995 cd12551, RRM_II_PABPN1L, RNA recognition motif in vertebrate type II embryonic polyadenylate-binding protein 2 (ePABP-2) Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240691 cd12245, RRM_scw1_like, RNA recognition motif in yeast cell wall integrity protein scw1 and similar proteins Back     alignment and domain information
>gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240763 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition motif 4 in RNA-binding protein 19 (RBM19) and RNA recognition motif 3 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|241059 cd12615, RRM1_TIA1, RNA recognition motif 1 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6), pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7), and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|241066 cd12622, RRM3_PUB1, RNA recognition motif 3 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|241203 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241029 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240705 cd12259, RRM_SRSF11_SREK1, RNA recognition motif in serine/arginine-rich splicing factor 11 (SRSF11), splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241060 cd12616, RRM1_TIAR, RNA recognition motif 1 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|240850 cd12404, RRM2_NCL, RNA recognition motif 2 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240727 cd12281, RRM1_TatSF1_like, RNA recognition motif 1 in HIV Tat-specific factor 1 (Tat-SF1) and similar proteins Back     alignment and domain information
>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) Back     alignment and domain information
>gnl|CDD|241036 cd12592, RRM_RBM7, RNA recognition motif in vertebrate RNA-binding protein 7 (RBM7) Back     alignment and domain information
>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240726 cd12280, RRM_FET, RNA recognition motif in the FET family of RNA-binding proteins Back     alignment and domain information
>gnl|CDD|240840 cd12394, RRM1_RBM34, RNA recognition motif 1 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|241087 cd12643, RRM_CFIm68, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6) and similar proteins Back     alignment and domain information
>gnl|CDD|241012 cd12568, RRM3_MRD1, RNA recognition motif 3 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit 4 (THOC4) and similar proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|241114 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 in yeast nucleolar protein 12 (Nop12p) and similar proteins Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|240674 cd12228, RRM_ENOX, RNA recognition motif (RRM) in the cell surface Ecto-NOX disulfide-thiol exchanger (ECTO-NOX or ENOX) proteins Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240851 cd12405, RRM3_NCL, RNA recognition motif 3 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240779 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|241204 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA-binding protein Musashi homolog 2 (Musashi-2 ) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 81
KOG0121|consensus153 99.8
KOG0149|consensus 247 99.65
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.63
KOG0126|consensus 219 99.58
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.57
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.55
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 99.53
KOG0113|consensus 335 99.53
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.49
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.43
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 99.43
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.41
KOG0122|consensus270 99.41
PLN03213 759 repressor of silencing 3; Provisional 99.4
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.39
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.38
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.38
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.37
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.37
COG0724 306 RNA-binding proteins (RRM domain) [General functio 99.35
PLN03120 260 nucleic acid binding protein; Provisional 99.34
KOG0117|consensus 506 99.33
PLN03121 243 nucleic acid binding protein; Provisional 99.32
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.3
KOG0144|consensus 510 99.27
KOG0127|consensus 678 99.27
KOG0124|consensus 544 99.26
KOG0131|consensus 203 99.24
KOG0148|consensus 321 99.23
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.22
KOG4205|consensus 311 99.22
KOG0108|consensus 435 99.2
KOG0111|consensus 298 99.17
KOG4207|consensus 256 99.16
smart0036272 RRM_2 RNA recognition motif. 99.16
KOG0125|consensus 376 99.15
KOG0130|consensus170 99.12
KOG0107|consensus 195 99.11
smart0036071 RRM RNA recognition motif. 99.11
KOG0145|consensus360 99.06
KOG0147|consensus 549 99.06
KOG0124|consensus 544 99.06
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.04
KOG0144|consensus 510 99.03
KOG0114|consensus124 99.02
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.98
KOG0148|consensus 321 98.98
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 98.96
KOG0145|consensus 360 98.95
KOG4208|consensus 214 98.94
KOG0105|consensus 241 98.91
KOG0127|consensus 678 98.87
KOG4205|consensus 311 98.87
KOG0415|consensus 479 98.84
KOG0109|consensus 346 98.81
KOG0110|consensus725 98.78
KOG0131|consensus203 98.75
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 98.7
KOG4209|consensus231 98.63
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 98.62
KOG0146|consensus371 98.6
KOG0146|consensus 371 98.59
KOG0116|consensus419 98.56
KOG0123|consensus 369 98.49
KOG0117|consensus 506 98.49
smart0036170 RRM_1 RNA recognition motif. 98.45
KOG0123|consensus369 98.35
KOG0109|consensus 346 98.35
KOG4212|consensus 608 98.35
KOG0132|consensus 894 98.28
KOG0226|consensus290 98.23
KOG4849|consensus 498 98.2
KOG4454|consensus 267 98.19
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.13
KOG0533|consensus 243 98.11
KOG4661|consensus 940 98.1
KOG4206|consensus 221 98.08
KOG0153|consensus 377 98.08
KOG0120|consensus 500 97.96
KOG4210|consensus285 97.92
KOG1548|consensus 382 97.87
KOG0151|consensus 877 97.79
KOG0110|consensus 725 97.77
KOG4212|consensus608 97.75
KOG0106|consensus 216 97.73
KOG0147|consensus 549 97.7
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 97.6
KOG4660|consensus 549 97.54
KOG4211|consensus 510 97.36
KOG4206|consensus221 97.14
KOG0129|consensus 520 96.95
KOG1457|consensus284 96.92
KOG1995|consensus 351 96.88
KOG0128|consensus881 96.76
KOG0129|consensus 520 96.72
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 96.58
KOG3152|consensus 278 96.47
KOG1190|consensus 492 96.42
KOG1457|consensus 284 96.29
KOG0115|consensus 275 96.09
KOG4211|consensus 510 95.46
KOG0105|consensus241 94.84
KOG0128|consensus 881 94.79
KOG1855|consensus 484 94.36
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 93.71
KOG2314|consensus 698 93.7
KOG1365|consensus 508 93.59
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 93.22
KOG1365|consensus 508 91.28
KOG1190|consensus492 91.23
KOG2193|consensus 584 90.57
KOG4676|consensus 479 90.47
KOG4307|consensus 944 90.04
KOG0112|consensus 975 90.02
KOG0106|consensus216 89.6
KOG1456|consensus 494 89.18
KOG1456|consensus 494 87.97
KOG0112|consensus 975 86.87
PF0970786 Cas_Cas2CT1978: CRISPR-associated protein (Cas_Cas 85.08
KOG2253|consensus 668 82.51
PF03467 176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 82.5
PRK1155897 putative ssRNA endonuclease; Provisional 80.37
>KOG0121|consensus Back     alignment and domain information
Probab=99.80  E-value=6.2e-20  Score=104.66  Aligned_cols=80  Identities=65%  Similarity=1.173  Sum_probs=75.3

Q ss_pred             ccccCCCccCccccccCCCCChHHHhhhcCCCCeEEEcCCCCCCCHHHHHHHhhcCCCeeEEEEeecCCCCCccceEEEC
Q psy518            2 TTVISPSVELSSYRDQHFKGSRAEQEKLLRTTSTLYVGNLSYYTTEEQLYELFSKCGDIKRIIMGLDKYKKTPCGFCFLE   81 (81)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~v~nl~~~~~~~~l~~~f~~~G~v~~~~~~~d~~tg~~~G~~fVe   81 (81)
                      +...+.....+.|+++++.++..++......+++||||||++.++|++|.++|+.+|+|.+|.+-.|+.+..++||||||
T Consensus         5 ~~~~~~~~~~s~Yr~~~f~gt~~e~~~a~r~S~tvyVgNlSfyttEEqiyELFs~cG~irriiMGLdr~kktpCGFCFVe   84 (153)
T KOG0121|consen    5 ARSFKRLDELSAYRDRRFRGTDEEQLEALRKSCTVYVGNLSFYTTEEQIYELFSKCGDIRRIIMGLDRFKKTPCGFCFVE   84 (153)
T ss_pred             hhhhcCccchhHHHHHHhcCchHHHHHHHhhcceEEEeeeeeeecHHHHHHHHHhccchheeEeccccCCcCccceEEEE
Confidence            44567788899999999999999999999999999999999999999999999999999999999999999999999996



>KOG0149|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>PF09707 Cas_Cas2CT1978: CRISPR-associated protein (Cas_Cas2CT1978); InterPro: IPR010152 Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) are a family of DNA direct repeats separated by regularly sized non-repetitive spacer sequences that are found in most bacterial and archaeal genomes [] Back     alignment and domain information
>KOG2253|consensus Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PRK11558 putative ssRNA endonuclease; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query81
1h2t_Z156 Structure Of The Human Nuclear Cap-Binding-Complex 2e-29
1h6k_Z98 Nuclear Cap Binding Complex Length = 98 4e-24
2jwn_A124 Solution Nmr Structure Of The Protease-Resistent Do 3e-06
2ki2_A90 Solution Structure Of Ss-Dna Binding Protein 12rnp2 7e-06
3ucg_A89 Crystal Structure Of A Rna Binding Domain Of Hypoth 7e-06
3b4d_A96 Crystal Structure Of Human Pabpn1 Rrm Length = 96 8e-06
2qfj_A 216 Crystal Structure Of First Two Rrm Domains Of Fir B 7e-05
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 2e-04
1whw_A99 Solution Structure Of The N-Terminal Rna Binding Do 3e-04
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 6e-04
3cw1_K216 Crystal Structure Of Human Spliceosomal U1 Snrnp Le 8e-04
>pdb|1H2T|Z Chain Z, Structure Of The Human Nuclear Cap-Binding-Complex (Cbc) In Complex With A Cap Analogue M7gpppg Length = 156 Back     alignment and structure

Iteration: 1

Score = 124 bits (310), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 57/73 (78%), Positives = 64/73 (87%) Query: 9 VELSSYRDQHFKGSRAEQEKLLRTTSTLYVGNLSYYTTEEQLYELFSKCGDIKRIIMGLD 68 VELS YRDQHF+G EQEKLL+ + TLYVGNLS+YTTEEQ+YELFSK GDIK+IIMGLD Sbjct: 15 VELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLD 74 Query: 69 KYKKTPCGFCFLE 81 K KKT CGFCF+E Sbjct: 75 KMKKTACGFCFVE 87
>pdb|1H6K|Z Chain Z, Nuclear Cap Binding Complex Length = 98 Back     alignment and structure
>pdb|2JWN|A Chain A, Solution Nmr Structure Of The Protease-Resistent Domain Of Xenopus Laevis Epabp2 Length = 124 Back     alignment and structure
>pdb|2KI2|A Chain A, Solution Structure Of Ss-Dna Binding Protein 12rnp2 Precursor, Hp0827(O25501_helpy) Form Helicobacter Pylori Length = 90 Back     alignment and structure
>pdb|3UCG|A Chain A, Crystal Structure Of A Rna Binding Domain Of Hypothetical Polyadenylate-Binding Protein (Pabpn1) From Homo Sapiens At 1.95 A Resolution Length = 89 Back     alignment and structure
>pdb|3B4D|A Chain A, Crystal Structure Of Human Pabpn1 Rrm Length = 96 Back     alignment and structure
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|1WHW|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain From Hypothetical Protein Bab23448 Length = 99 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|3CW1|K Chain K, Crystal Structure Of Human Spliceosomal U1 Snrnp Length = 216 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query81
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 3e-38
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 1e-18
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 4e-16
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 6e-16
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 8e-16
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 5e-15
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 6e-15
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 9e-15
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 1e-14
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 1e-14
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 2e-14
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 2e-14
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 3e-14
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-14
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 4e-14
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 4e-14
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 6e-14
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 7e-14
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 9e-14
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 1e-13
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 1e-13
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 1e-13
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 2e-13
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 2e-13
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 2e-13
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 3e-13
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 3e-13
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 3e-13
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 7e-13
2cpj_A99 Non-POU domain-containing octamer-binding protein; 8e-13
2cph_A107 RNA binding motif protein 19; RNA recognition moti 1e-12
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 1e-12
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 1e-12
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 1e-12
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 1e-12
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 1e-12
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 1e-12
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 1e-12
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 2e-12
2div_A99 TRNA selenocysteine associated protein; structural 2e-12
2qfj_A 216 FBP-interacting repressor; protein-DNA complex; HE 2e-12
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 6e-08
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 2e-12
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 4e-12
2la6_A99 RNA-binding protein FUS; structural genomics, nort 4e-12
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 5e-12
3q2s_C 229 Cleavage and polyadenylation specificity factor S; 7e-12
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 8e-12
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 8e-12
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 8e-12
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 9e-12
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 9e-12
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-11
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-09
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 7e-07
2dis_A109 Unnamed protein product; structural genomics, RRM 1e-11
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 1e-11
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 1e-11
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 6e-06
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 1e-11
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 2e-11
1fje_B 175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 8e-11
2i2y_A150 Fusion protein consists of immunoglobin G- binding 2e-11
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 2e-11
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 3e-11
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 3e-11
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 4e-11
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 5e-11
1fxl_A 167 Paraneoplastic encephalomyelitis antigen HUD; prot 5e-11
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 3e-06
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 6e-11
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 7e-11
2cjk_A 167 Nuclear polyadenylated RNA-binding protein 4; HRP1 2e-09
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 7e-11
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 6e-10
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 3e-09
3p5t_L90 Cleavage and polyadenylation specificity factor S; 7e-11
3n9u_C156 Cleavage and polyadenylation specificity factor S; 7e-11
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 9e-11
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 1e-10
1l3k_A 196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 4e-10
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 1e-10
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 1e-10
2g4b_A 172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 4e-10
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 1e-10
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 1e-10
1b7f_A 168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 1e-10
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 6e-08
4f02_A 213 Polyadenylate-binding protein 1; mRNA, eukaryotic 1e-10
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 5e-05
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 2e-10
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 2e-10
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 2e-10
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 3e-10
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 3e-10
2yh0_A 198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 8e-10
3md3_A 166 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-10
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-05
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 4e-10
2kt5_A124 RNA and export factor-binding protein 2; chaperone 5e-10
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 5e-10
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 5e-10
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 6e-10
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 6e-10
2f3j_A177 RNA and export factor binding protein 2; RRM domai 6e-10
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 6e-10
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 6e-10
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 7e-10
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 7e-10
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-09
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 1e-09
3nmr_A 175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 1e-09
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 6e-07
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 1e-09
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 2e-09
1x4e_A85 RNA binding motif, single-stranded interacting pro 2e-09
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 2e-09
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 2e-09
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 3e-09
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 3e-09
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 4e-09
1x5o_A114 RNA binding motif, single-stranded interacting pro 4e-09
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 4e-09
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 5e-09
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-05
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 5e-09
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 7e-09
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 1e-08
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-08
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 1e-08
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 1e-08
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 2e-08
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 2e-08
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 2e-08
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 2e-08
1qm9_A 198 Polypyrimidine tract-binding protein; ribonucleopr 2e-05
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 2e-08
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 2e-08
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 2e-08
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 2e-08
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 3e-08
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 4e-08
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 4e-08
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 5e-08
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 6e-08
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 6e-08
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 6e-08
1x5p_A97 Negative elongation factor E; structure genomics, 6e-08
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 7e-08
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 8e-08
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 9e-08
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 1e-07
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 1e-07
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 4e-05
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 1e-07
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 1e-07
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 1e-07
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 2e-07
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-07
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 9e-07
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 2e-07
2cqd_A116 RNA-binding region containing protein 1; RNA recog 2e-07
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 3e-07
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 3e-07
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 4e-07
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 4e-07
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 5e-07
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 5e-07
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 5e-07
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 8e-07
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 1e-06
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 1e-06
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 2e-06
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 2e-06
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 2e-06
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 3e-06
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 3e-06
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 1e-05
2dnl_A114 Cytoplasmic polyadenylation element binding protei 2e-05
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 2e-05
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 2e-05
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 3e-05
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 4e-05
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 7e-05
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 1e-04
2krb_A81 Eukaryotic translation initiation factor 3 subunit 1e-04
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 2e-04
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 3e-04
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
 Score =  123 bits (311), Expect = 3e-38
 Identities = 57/75 (76%), Positives = 64/75 (85%)

Query: 7  PSVELSSYRDQHFKGSRAEQEKLLRTTSTLYVGNLSYYTTEEQLYELFSKCGDIKRIIMG 66
            VELS YRDQHF+G   EQEKLL+ + TLYVGNLS+YTTEEQ+YELFSK GDIK+IIMG
Sbjct: 13 SYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMG 72

Query: 67 LDKYKKTPCGFCFLE 81
          LDK KKT CGFCF+E
Sbjct: 73 LDKMKKTACGFCFVE 87


>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query81
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.77
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.74
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.73
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.73
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.73
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.73
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.7
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.7
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.69
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.69
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.69
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.68
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.68
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.68
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.68
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.68
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.68
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.67
2div_A99 TRNA selenocysteine associated protein; structural 99.67
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.67
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.67
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.67
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.67
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.67
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.67
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.67
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.67
4f02_A 213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.67
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.66
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.66
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.66
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.66
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.66
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.66
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.66
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.66
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.65
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.65
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.65
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.65
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.65
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.65
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.65
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.65
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.65
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.65
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.65
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.64
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.64
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.64
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.64
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.64
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.64
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.64
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.64
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.64
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.64
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.64
3q2s_C 229 Cleavage and polyadenylation specificity factor S; 99.64
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.64
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.63
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.63
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.63
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.63
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.63
1l3k_A 196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.62
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.62
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.62
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.62
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.62
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.62
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.62
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.62
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.62
2cjk_A 167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.62
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.61
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.61
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.61
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.61
2dis_A109 Unnamed protein product; structural genomics, RRM 99.61
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.61
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.61
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.61
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.6
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.6
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.6
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.6
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.6
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.6
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.6
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.6
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.59
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.59
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.59
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.58
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.58
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.58
3nmr_A 175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.58
1fxl_A 167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.57
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.57
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.57
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.57
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.56
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.56
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.56
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.56
1b7f_A 168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.56
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.56
2qfj_A 216 FBP-interacting repressor; protein-DNA complex; HE 99.55
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.55
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.55
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.54
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.31
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.54
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.53
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.53
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.52
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.52
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.51
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.51
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.5
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.5
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.5
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.5
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.49
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.49
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.48
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.48
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.48
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.48
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.47
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.47
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.47
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.47
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.46
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.46
3md3_A 166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.46
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.45
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.45
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.44
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.44
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.44
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.44
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.44
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.43
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.43
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.43
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.43
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.43
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.43
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.42
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.42
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.42
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.42
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.39
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.39
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.39
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.39
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.38
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.38
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 99.38
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.37
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.36
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.36
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.35
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.34
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.34
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.34
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.34
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.32
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.32
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.31
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.31
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.31
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.3
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.3
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.29
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.29
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.29
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.28
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.27
1x5p_A97 Negative elongation factor E; structure genomics, 99.25
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.24
1fje_B 175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.23
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.22
1qm9_A 198 Polypyrimidine tract-binding protein; ribonucleopr 99.22
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.21
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 99.18
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.18
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.17
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.17
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.17
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.16
2yh0_A 198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.06
2g4b_A 172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.04
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.03
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.01
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 98.98
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 98.92
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 98.82
2dit_A112 HIV TAT specific factor 1 variant; structural geno 98.82
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.8
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 98.74
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 98.71
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 97.98
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 97.78
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 97.06
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 96.21
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 95.98
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 95.84
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 95.84
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 95.42
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 94.17
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 93.43
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 91.4
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 87.01
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
Probab=99.77  E-value=1e-18  Score=95.67  Aligned_cols=53  Identities=26%  Similarity=0.386  Sum_probs=49.3

Q ss_pred             hcCCCCeEEEcCCCCCCCHHHHHHHhhcCCCeeEEEEeecCCCCCccceEEEC
Q psy518           29 LLRTTSTLYVGNLSYYTTEEQLYELFSKCGDIKRIIMGLDKYKKTPCGFCFLE   81 (81)
Q Consensus        29 ~~~~~~~l~v~nl~~~~~~~~l~~~f~~~G~v~~~~~~~d~~tg~~~G~~fVe   81 (81)
                      ....+++|||+|||+++++++|+++|++||.|.++++++|+.+|+++|||||+
T Consensus        15 ~~~~gt~lfV~nLp~~~te~~L~~~F~~~G~I~~v~i~~d~~tg~~kG~afV~   67 (99)
T 4fxv_A           15 LYFQGTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVN   67 (99)
T ss_dssp             -CCCCSEEEEESCCTTCCHHHHHHHHHTTSCEEEEEEEECSSSCCEEEEEEEE
T ss_pred             ccCCCCEEEEeCCCCCCCHHHHHHHHHhcCCEEEeEeeecCCCCcccccEEEE
Confidence            34567899999999999999999999999999999999999999999999995



>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 81
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 3e-15
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 1e-12
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 2e-12
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 4e-12
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 5e-12
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 5e-12
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 2e-11
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 4e-11
d1u1qa_ 183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 4e-11
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 8e-07
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 6e-11
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 1e-10
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 1e-10
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-10
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 2e-10
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 2e-10
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-10
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 3e-10
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 4e-10
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 5e-10
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 1e-09
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 1e-09
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 1e-09
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-09
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 2e-09
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 3e-09
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 5e-09
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 6e-09
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 6e-09
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 1e-08
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 1e-08
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 1e-08
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 1e-08
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 2e-08
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 2e-08
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 2e-08
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 3e-08
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 3e-08
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 3e-08
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 6e-08
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 6e-08
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 8e-08
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 1e-07
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 1e-07
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 2e-07
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-07
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 2e-07
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 2e-07
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 2e-07
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 3e-07
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 4e-07
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 4e-07
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 5e-07
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 6e-07
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 8e-07
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 1e-06
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 1e-06
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 1e-06
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 3e-06
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 3e-06
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 4e-06
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 5e-06
d1wg5a_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 6e-06
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 2e-05
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 2e-05
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 5e-05
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 5e-05
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 5e-05
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 6e-05
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 6e-05
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 6e-05
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 7e-05
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 1e-04
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 1e-04
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 4e-04
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 7e-04
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 0.002
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 0.002
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 0.004
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: CBP20, 20KDa nuclear cap-binding protein
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 62.3 bits (151), Expect = 3e-15
 Identities = 44/55 (80%), Positives = 50/55 (90%)

Query: 27 EKLLRTTSTLYVGNLSYYTTEEQLYELFSKCGDIKRIIMGLDKYKKTPCGFCFLE 81
          EKLL+ + TLYVGNLS+YTTEEQ+YELFSK GDIK+IIMGLDK KKT CGFCF+E
Sbjct: 1  EKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVE 55


>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query81
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.8
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.79
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.78
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.78
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.77
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.77
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.77
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.76
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.76
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.76
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.76
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.75
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.75
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.75
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.75
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.75
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.74
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.74
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.74
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.73
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.73
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.72
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.72
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.72
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.71
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.71
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.71
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.7
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.68
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.67
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.65
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.65
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.65
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.65
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.65
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.63
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.62
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.62
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.62
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.6
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.6
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.59
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.59
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.56
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.56
d1u1qa_ 183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.55
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.55
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.54
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.53
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.53
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.53
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.53
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.52
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.51
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.5
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.5
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.5
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.49
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.48
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.48
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.47
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.46
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.46
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.46
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.45
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.43
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.42
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.42
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.41
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.41
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.4
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.39
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.39
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.34
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.34
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.34
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.33
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.3
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.29
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.25
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.24
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.18
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 98.96
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 98.96
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 98.87
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 98.32
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.29
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 95.96
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 89.7
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: TAR DNA-binding protein 43, TDP-43
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.80  E-value=6.9e-20  Score=97.77  Aligned_cols=52  Identities=33%  Similarity=0.438  Sum_probs=48.9

Q ss_pred             cCCCCeEEEcCCCCCCCHHHHHHHhhcCCCeeEEEEeecCCCCCccceEEEC
Q psy518           30 LRTTSTLYVGNLSYYTTEEQLYELFSKCGDIKRIIMGLDKYKKTPCGFCFLE   81 (81)
Q Consensus        30 ~~~~~~l~v~nl~~~~~~~~l~~~f~~~G~v~~~~~~~d~~tg~~~G~~fVe   81 (81)
                      .....+|||+|||+++++++|+++|++||.|.+|+|+.|+.+|+++|||||+
T Consensus         5 ~~~~~~lfV~nLp~~~te~~l~~~F~~~G~i~~v~i~~d~~tg~srG~aFV~   56 (90)
T d2cqga1           5 VQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVR   56 (90)
T ss_dssp             CCCCCCEEEESCCSSCCHHHHHHHHGGGSCEEEEEEEECSSSCSEEEEEEEE
T ss_pred             CcCCCeEEEECCCCCCCHHHHHHHHHhhcccceeeeccCCCCcccCCEEEEE
Confidence            3466889999999999999999999999999999999999999999999995



>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure