Diaphorina citri psyllid: psy5190


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290--
MSQNKKPAVGEIHEVDLREDYSPVGVNIPPPHPTSLDLSHTMAPMSFPTSPSGNSEGNPKSPVSKIESIKNWGISTYKCTRQIMYEKLGKSTRTVDSDLKSRVLVIFFLQQTLGEAFADLAQKSPELQEEFLCNSETQRNLTGTGEILLNALNLFVSSVNTLCNKTIEDTLVTVRQYENARVEYDAYRTDLELLLQVTSNVDSNCSHLDEAQRNFQTHRENFEKLRNDVVVKLRFLDENRIKVMHKQLLLFHNAISAYFSGNEPGLQATLKQFNIKTNKIPSQNSMLYSAEH
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccccccccccccccccc
*******************************************************************SIKNWGISTYKCTRQIMYEKLGKSTRTVDSDLKSRVLVIFFLQQTLGEAFADLAQKSPELQEEFLCNSETQRNLTGTGEILLNALNLFVSSVNTLCNKTIEDTLVTVRQYENARVEYDAYRTDLELLLQVTSNVDSNCSHLDEAQRNFQTHRENFEKLRNDVVVKLRFLDENRIKVMHKQLLLFHNAISAYFSGNEPGLQATLKQFNI*****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQNKKPAVGEIHEVDLREDYSPVGVNIPPPHPTSLDLSHTMAPMSFPTSPSGNSEGNPKSPVSKIESIKNWGISTYKCTRQIMYEKLGKSTRTVDSDLKSRVLVIFFLQQTLGEAFADLAQKSPELQEEFLCNSETQRNLTGTGEILLNALNLFVSSVNTLCNKTIEDTLVTVRQYENARVEYDAYRTDLELLLQVTSNVDSNCSHxxxxxxxxxxxxxxxxxxxxxVVVKLRFLDENRIKVMHKQLLLFHNAISAYFSGNEPGLQATLKQFNIKTNKIPSQNSMLYSAEH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Arfaptin-2 Putative target protein of ADP-ribosylation factor. Involved in membrane ruffling.confidentQ3ZCL5
Arfaptin-2 Putative target protein of ADP-ribosylation factor. Involved in membrane ruffling.confidentQ8K221
Arfaptin-2 Putative target protein of ADP-ribosylation factor. Involved in membrane ruffling.confidentQ6AY65

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0050708 [BP]regulation of protein secretionprobableGO:0070201, GO:0051223, GO:0051046, GO:0060341, GO:0051049, GO:0050794, GO:0065007, GO:0008150, GO:0032879, GO:0050789, GO:0032880
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0000139 [CC]Golgi membraneprobableGO:0005737, GO:0005794, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0012505, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0006886 [BP]intracellular protein transportprobableGO:0033036, GO:0034613, GO:0046907, GO:0070727, GO:0006810, GO:0045184, GO:0008104, GO:0044763, GO:0044699, GO:0071702, GO:0015031, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0051649, GO:0051641

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I4D, chain A
Confidence level:very confident
Coverage over the Query: 92-195,209-268
View the alignment between query and template
View the model in PyMOL
Template: 4H8S, chain A
Confidence level:probable
Coverage over the Query: 63-87,104-265
View the alignment between query and template
View the model in PyMOL