Psyllid ID: psy5212


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-
MEFLRLKRSRLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVAHVRAERDVLVEADHQWVIGRGVFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVAHVRAERDVLVEADHQWVVKMYYSFQSV
cccccccccccccccccEEEEEEcccccEEEEEEEcccccEEEEEEccHHHHHHHcHHHHHHHHHHHHHHccccEEEccccccEEEEEEEEccccEEHHccccccccccHHHHHHHHHHHHHHHHcccccEEcEEEEEccc
ccHHHHHHHcccHHHccEEEEEEcccccEEEEEEEcccccEEEHHHEcHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccEEEEEEEcccccEEEEEEEEHHHHHHcccHHHHHHHHHHHHHcccccEccEEEEEEcc
meflrlkrsrlgvedfeplkvigrgafgevrlvqkkdTGHVYAMKILRKADMLEKEQVAHVRAERDVLVEADHQWVIGRGVFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVAHVRAERDVLVEADHQWVVKMYYSFQSV
meflrlkrsrlgvedfeplkvigrgafgevrlvqkkdtGHVYAMKILRKADMLEKEQVAHVRAERDVLveadhqwvigrgvfgevrlvqkkdtGHVYAMKILRKADMLEKEQVAHVRAERDVLVEADHQWVVKMYYSFQSV
MEFLRLKRSRLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVAHVRAERDVLVEADHQWVIGRGVFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVAHVRAERDVLVEADHQWVVKMYYSFQSV
**********LGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVAHVRAERDVLVEADHQWVIGRGVFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVAHVRAERDVLVEADHQWVVKMYYSF***
*EFL***RSRLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVAHVRAERDVLVEADHQWVIGRGVFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVAHVRAERDVLVEADHQWVVKMYYSFQSV
MEFLRLKRSRLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVAHVRAERDVLVEADHQWVIGRGVFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVAHVRAERDVLVEADHQWVVKMYYSFQSV
MEFLRLKRSRLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVAHVRAERDVLVEADHQWVIGRGVFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVAHVRAERDVLVEADHQWVVKMYYSFQSV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEFLRLKRSRLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVAHVRAERDVLVEADHQWVIGRGVFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVAHVRAERDVLVEADHQWVVKMYYSFQSV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query141 2.2.26 [Sep-21-2011]
Q9NBK5 463 Serine/threonine-protein yes N/A 0.539 0.164 0.934 5e-35
Q2LZZ7 458 Serine/threonine-protein yes N/A 0.539 0.165 0.934 6e-35
Q7TSE6 464 Serine/threonine-protein yes N/A 0.872 0.265 0.573 3e-34
Q9Y2H1 464 Serine/threonine-protein yes N/A 0.872 0.265 0.566 1e-33
A2VDV2 465 Serine/threonine-protein no N/A 0.858 0.260 0.572 1e-33
Q91VJ4 465 Serine/threonine-protein no N/A 0.858 0.260 0.572 1e-33
Q5R8M1 465 Serine/threonine-protein no N/A 0.858 0.260 0.572 1e-33
Q15208 465 Serine/threonine-protein no N/A 0.858 0.260 0.572 1e-33
A8XJL7 472 Serine/threonine-protein N/A N/A 0.524 0.156 0.776 5e-29
Q2L6W9 476 Serine/threonine-protein yes N/A 0.524 0.155 0.776 9e-29
>sp|Q9NBK5|TRC_DROME Serine/threonine-protein kinase tricorner OS=Drosophila melanogaster GN=trc PE=1 SV=1 Back     alignment and function desciption
 Score =  146 bits (368), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 71/76 (93%), Positives = 74/76 (97%)

Query: 2   EFLRLKRSRLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVAHV 61
           E+LRLKR RLGVEDFE LKVIGRGAFGEVRLVQKKDTGHVYAMK+LRKADMLEKEQVAHV
Sbjct: 79  EYLRLKRLRLGVEDFEALKVIGRGAFGEVRLVQKKDTGHVYAMKVLRKADMLEKEQVAHV 138

Query: 62  RAERDVLVEADHQWVI 77
           RAERDVLVEADHQWV+
Sbjct: 139 RAERDVLVEADHQWVV 154




Has an important role, with fry, in controlling cell structure and proliferation of a variety of polarized outgrowths including epidermal hairs, bristles, arista laterals, and dendrites. Affects cellular morphogenesis by regulating the expression of target genes that encode cytoskeleton-interacting proteins and not via the direct modification of the cytoskeleton. Maintains the integrity of epidermal hairs and is an essential component of the signaling pathway regulating dendritic branching of sensory neurons.
Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q2LZZ7|TRC_DROPS Serine/threonine-protein kinase tricorner OS=Drosophila pseudoobscura pseudoobscura GN=trc PE=3 SV=1 Back     alignment and function description
>sp|Q7TSE6|ST38L_MOUSE Serine/threonine-protein kinase 38-like OS=Mus musculus GN=Stk38l PE=1 SV=2 Back     alignment and function description
>sp|Q9Y2H1|ST38L_HUMAN Serine/threonine-protein kinase 38-like OS=Homo sapiens GN=STK38L PE=1 SV=3 Back     alignment and function description
>sp|A2VDV2|STK38_BOVIN Serine/threonine-protein kinase 38 OS=Bos taurus GN=STK38 PE=1 SV=1 Back     alignment and function description
>sp|Q91VJ4|STK38_MOUSE Serine/threonine-protein kinase 38 OS=Mus musculus GN=Stk38 PE=1 SV=1 Back     alignment and function description
>sp|Q5R8M1|STK38_PONAB Serine/threonine-protein kinase 38 OS=Pongo abelii GN=STK38 PE=1 SV=1 Back     alignment and function description
>sp|Q15208|STK38_HUMAN Serine/threonine-protein kinase 38 OS=Homo sapiens GN=STK38 PE=1 SV=1 Back     alignment and function description
>sp|A8XJL7|SAX1_CAEBR Serine/threonine-protein kinase sax-1 OS=Caenorhabditis briggsae GN=sax-1 PE=3 SV=2 Back     alignment and function description
>sp|Q2L6W9|SAX1_CAEEL Serine/threonine-protein kinase sax-1 OS=Caenorhabditis elegans GN=sax-1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query141
383855850 594 PREDICTED: serine/threonine-protein kina 0.517 0.122 0.986 1e-36
328791460 585 PREDICTED: serine/threonine-protein kina 0.517 0.124 0.986 2e-36
340729211 576 PREDICTED: serine/threonine-protein kina 0.517 0.126 0.986 2e-36
350416834 576 PREDICTED: serine/threonine-protein kina 0.517 0.126 0.986 2e-36
380017040 539 PREDICTED: serine/threonine-protein kina 0.517 0.135 0.986 3e-36
332021401 516 Serine/threonine-protein kinase 38-like 0.539 0.147 0.986 4e-36
307190828 464 Serine/threonine-protein kinase 38-like 0.539 0.163 0.986 6e-36
307204824 464 Serine/threonine-protein kinase 38-like 0.539 0.163 0.986 7e-36
357609789 459 putative serine/threonine-protein kinase 0.858 0.263 0.615 7e-36
350416836 464 PREDICTED: serine/threonine-protein kina 0.539 0.163 0.986 7e-36
>gi|383855850|ref|XP_003703423.1| PREDICTED: serine/threonine-protein kinase tricorner-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 75/76 (98%), Positives = 76/76 (100%)

Query: 2   EFLRLKRSRLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVAHV 61
           EFLRLKRSRLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVAHV
Sbjct: 203 EFLRLKRSRLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVAHV 262

Query: 62  RAERDVLVEADHQWVI 77
           RAERDVLVEADHQWV+
Sbjct: 263 RAERDVLVEADHQWVV 278




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328791460|ref|XP_001120829.2| PREDICTED: serine/threonine-protein kinase tricorner [Apis mellifera] Back     alignment and taxonomy information
>gi|340729211|ref|XP_003402900.1| PREDICTED: serine/threonine-protein kinase tricorner-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350416834|ref|XP_003491126.1| PREDICTED: serine/threonine-protein kinase tricorner-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|380017040|ref|XP_003692474.1| PREDICTED: serine/threonine-protein kinase tricorner-like, partial [Apis florea] Back     alignment and taxonomy information
>gi|332021401|gb|EGI61769.1| Serine/threonine-protein kinase 38-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307190828|gb|EFN74680.1| Serine/threonine-protein kinase 38-like [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307204824|gb|EFN83382.1| Serine/threonine-protein kinase 38-like [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|357609789|gb|EHJ66673.1| putative serine/threonine-protein kinase 38 [Danaus plexippus] Back     alignment and taxonomy information
>gi|350416836|ref|XP_003491127.1| PREDICTED: serine/threonine-protein kinase tricorner-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query141
UNIPROTKB|Q2LZZ7 458 trc "Serine/threonine-protein 0.893 0.275 0.616 7.4e-34
FB|FBgn0003744 463 trc "tricornered" [Drosophila 0.900 0.274 0.621 9.5e-34
UNIPROTKB|E1C2E1 470 STK38L "Uncharacterized protei 0.900 0.270 0.606 2.5e-33
UNIPROTKB|E1C2E2 466 STK38L "Uncharacterized protei 0.900 0.272 0.606 2.5e-33
UNIPROTKB|F1P1V1 473 STK38L "Uncharacterized protei 0.900 0.268 0.606 2.5e-33
UNIPROTKB|A7MB32 464 STK38L "STK38L protein" [Bos t 0.900 0.273 0.606 3.2e-33
UNIPROTKB|E2R001 464 STK38L "Uncharacterized protei 0.900 0.273 0.606 3.2e-33
MGI|MGI:1922250 464 Stk38l "serine/threonine kinas 0.900 0.273 0.606 3.2e-33
ZFIN|ZDB-GENE-040426-798 464 stk38l "serine/threonine kinas 0.900 0.273 0.606 5.2e-33
UNIPROTKB|Q9Y2H1 464 STK38L "Serine/threonine-prote 0.900 0.273 0.598 6.7e-33
UNIPROTKB|Q2LZZ7 trc "Serine/threonine-protein kinase tricorner" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] Back     alignment and assigned GO terms
 Score = 368 (134.6 bits), Expect = 7.4e-34, P = 7.4e-34
 Identities = 82/133 (61%), Positives = 97/133 (72%)

Query:     2 EFLRLKRSRLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVAHV 61
             E+LRLKR RLGVEDFE LKVIGRGAFGEVRLVQKKDTGHVYAMK+LRKADMLEKEQVAHV
Sbjct:    78 EYLRLKRLRLGVEDFEALKVIGRGAFGEVRLVQKKDTGHVYAMKVLRKADMLEKEQVAHV 137

Query:    62 RAERDVLVEADHQWVIGR--GVFGEVRL---VQKKDTGHVYAMKILRKADMLEKEQVAHV 116
             RAERDVLVEADHQWV+        +V L   ++    G +  M +L K D L +E     
Sbjct:   138 RAERDVLVEADHQWVVKMYYSFQDQVNLYLIMEFLPGGDM--MTLLMKKDTLSEEGTQFY 195

Query:   117 RAERDVLVEADHQ 129
              +E  + +++ H+
Sbjct:   196 ISETALAIDSIHK 208


GO:0004674 "protein serine/threonine kinase activity" evidence=ISS
GO:0005524 "ATP binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISS
GO:0006468 "protein phosphorylation" evidence=ISS
GO:0007165 "signal transduction" evidence=ISS
GO:0007243 "intracellular protein kinase cascade" evidence=ISS
GO:0050773 "regulation of dendrite development" evidence=ISS
FB|FBgn0003744 trc "tricornered" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E1C2E1 STK38L "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C2E2 STK38L "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P1V1 STK38L "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A7MB32 STK38L "STK38L protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R001 STK38L "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1922250 Stk38l "serine/threonine kinase 38 like" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-798 stk38l "serine/threonine kinase 38 like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y2H1 STK38L "Serine/threonine-protein kinase 38-like" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9Y2H1ST38L_HUMAN2, ., 7, ., 1, 1, ., 10.56610.87230.2650yesN/A
P31034CBK1_KLULA2, ., 7, ., 1, 1, ., 10.68750.45390.0891yesN/A
Q7TSE6ST38L_MOUSE2, ., 7, ., 1, 1, ., 10.57350.87230.2650yesN/A
P53894CBK1_YEAST2, ., 7, ., 1, 1, ., 10.68750.45390.0846yesN/A
Q54Y26NDRA_DICDI2, ., 7, ., 1, 1, ., 10.52630.64530.1716yesN/A
Q6CFS5CBK1_YARLI2, ., 7, ., 1, 1, ., 10.58660.51770.1241yesN/A
Q2L6W9SAX1_CAEEL2, ., 7, ., 1, 1, ., 10.77630.52480.1554yesN/A
Q6FP74CBK1_CANGA2, ., 7, ., 1, 1, ., 10.67180.45390.0827yesN/A
Q754N7CBK1_ASHGO2, ., 7, ., 1, 1, ., 10.68750.45390.0890yesN/A
Q2LZZ7TRC_DROPS2, ., 7, ., 1, 1, ., 10.93420.53900.1659yesN/A
Q6BLJ9CBK1_DEBHA2, ., 7, ., 1, 1, ., 10.63150.52480.1033yesN/A
O13310ORB6_SCHPO2, ., 7, ., 1, 1, ., 10.63150.53190.1599yesN/A
Q9NBK5TRC_DROME2, ., 7, ., 1, 1, ., 10.93420.53900.1641yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.11LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
cd05599 364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 1e-43
cd05599 364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 4e-42
cd05627 360 cd05627, STKc_NDR2, Catalytic domain of the Protei 7e-37
cd05627 360 cd05627, STKc_NDR2, Catalytic domain of the Protei 2e-36
cd05628 363 cd05628, STKc_NDR1, Catalytic domain of the Protei 2e-35
cd05628 363 cd05628, STKc_NDR1, Catalytic domain of the Protei 5e-35
cd05573 350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 2e-33
cd05573 350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 1e-32
cd05629 377 cd05629, STKc_NDR_like_fungal, Catalytic domain of 1e-32
cd05629 377 cd05629, STKc_NDR_like_fungal, Catalytic domain of 9e-31
cd05598 376 cd05598, STKc_LATS, Catalytic domain of the Protei 8e-29
cd05123 250 cd05123, STKc_AGC, Catalytic domain of AGC family 2e-26
cd05598 376 cd05598, STKc_LATS, Catalytic domain of the Protei 4e-25
cd05597 331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 4e-24
cd05626 381 cd05626, STKc_LATS2, Catalytic domain of the Prote 4e-24
cd05625 382 cd05625, STKc_LATS1, Catalytic domain of the Prote 3e-23
cd05597 331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 4e-22
cd05579 265 cd05579, STKc_MAST_like, Catalytic domain of Micro 2e-21
cd05625 382 cd05625, STKc_LATS1, Catalytic domain of the Prote 1e-20
cd05626 381 cd05626, STKc_LATS2, Catalytic domain of the Prote 2e-20
cd05596 370 cd05596, STKc_ROCK, Catalytic domain of the Protei 3e-20
cd05123 250 cd05123, STKc_AGC, Catalytic domain of AGC family 5e-20
cd05580 290 cd05580, STKc_PKA, Catalytic domain of the Protein 9e-20
cd05624 331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 4e-19
cd05578 258 cd05578, STKc_Yank1, Catalytic domain of the Prote 8e-19
cd05580 290 cd05580, STKc_PKA, Catalytic domain of the Protein 2e-18
cd05623 332 cd05623, STKc_MRCK_alpha, Catalytic domain of the 3e-18
cd05600 333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 4e-18
cd05624 331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 5e-18
cd05596 370 cd05596, STKc_ROCK, Catalytic domain of the Protei 7e-18
cd05610 669 cd05610, STKc_MASTL, Catalytic domain of the Prote 2e-17
cd05601 330 cd05601, STKc_CRIK, Catalytic domain of the Protei 6e-17
cd05623 332 cd05623, STKc_MRCK_alpha, Catalytic domain of the 8e-17
smart00220 254 smart00220, S_TKc, Serine/Threonine protein kinase 1e-16
cd05611 260 cd05611, STKc_Rim15_like, Catalytic domain of fung 1e-16
cd05574 316 cd05574, STKc_phototropin_like, Catalytic domain o 2e-16
cd05622 371 cd05622, STKc_ROCK1, Catalytic domain of the Prote 2e-16
cd05574 316 cd05574, STKc_phototropin_like, Catalytic domain o 3e-16
smart00220 254 smart00220, S_TKc, Serine/Threonine protein kinase 6e-16
cd05610 669 cd05610, STKc_MASTL, Catalytic domain of the Prote 7e-16
cd05578 258 cd05578, STKc_Yank1, Catalytic domain of the Prote 1e-15
cd05601 330 cd05601, STKc_CRIK, Catalytic domain of the Protei 1e-15
cd05579 265 cd05579, STKc_MAST_like, Catalytic domain of Micro 2e-15
cd05622 371 cd05622, STKc_ROCK1, Catalytic domain of the Prote 2e-15
cd05600 333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 5e-15
cd05575 323 cd05575, STKc_SGK, Catalytic domain of the Protein 5e-15
cd05572 262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 6e-15
cd05586 330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 9e-15
cd05621 370 cd05621, STKc_ROCK2, Catalytic domain of the Prote 9e-15
PTZ00263 329 PTZ00263, PTZ00263, protein kinase A catalytic sub 1e-14
cd05585 312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 1e-14
cd05582 318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 2e-14
cd05571 323 cd05571, STKc_PKB, Catalytic domain of the Protein 6e-14
cd05572 262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 2e-13
cd05621 370 cd05621, STKc_ROCK2, Catalytic domain of the Prote 2e-13
cd05586 330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 6e-13
cd05603 321 cd05603, STKc_SGK2, Catalytic domain of the Protei 6e-13
PTZ00263 329 PTZ00263, PTZ00263, protein kinase A catalytic sub 8e-13
cd05594 325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 9e-13
cd05611 260 cd05611, STKc_Rim15_like, Catalytic domain of fung 1e-12
cd05584 323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 1e-12
cd05581 280 cd05581, STKc_PDK1, Catalytic domain of the Protei 1e-12
cd05614 332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 1e-12
cd05575 323 cd05575, STKc_SGK, Catalytic domain of the Protein 2e-12
cd05581 280 cd05581, STKc_PDK1, Catalytic domain of the Protei 2e-12
cd05595 323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 4e-12
cd05604 325 cd05604, STKc_SGK3, Catalytic domain of the Protei 5e-12
cd05583 288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 9e-12
cd05612 291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 9e-12
cd05582 318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 1e-11
cd05585 312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 2e-11
cd05571 323 cd05571, STKc_PKB, Catalytic domain of the Protein 2e-11
cd05612 291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 2e-11
cd05609 305 cd05609, STKc_MAST, Catalytic domain of the Protei 2e-11
cd05593 328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 2e-11
cd05594 325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 1e-10
cd05584 323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 1e-10
cd05602 325 cd05602, STKc_SGK1, Catalytic domain of the Protei 1e-10
cd05614 332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 2e-10
cd05583 288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 2e-10
cd05609 305 cd05609, STKc_MAST, Catalytic domain of the Protei 3e-10
cd05613 290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 3e-10
cd05603 321 cd05603, STKc_SGK2, Catalytic domain of the Protei 4e-10
pfam00069 260 pfam00069, Pkinase, Protein kinase domain 4e-10
cd05595 323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 5e-10
cd05604 325 cd05604, STKc_SGK3, Catalytic domain of the Protei 6e-10
cd05589 324 cd05589, STKc_PKN, Catalytic domain of the Protein 2e-09
pfam00069 260 pfam00069, Pkinase, Protein kinase domain 3e-09
cd05570 318 cd05570, STKc_PKC, Catalytic domain of the Protein 3e-09
cd05589 324 cd05589, STKc_PKN, Catalytic domain of the Protein 4e-09
cd08215 258 cd08215, STKc_Nek, Catalytic domain of the Protein 4e-09
cd05602 325 cd05602, STKc_SGK1, Catalytic domain of the Protei 9e-09
cd05593 328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 1e-08
cd05613 290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 1e-08
cd05590 320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 1e-08
cd06623 264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 2e-08
cd05570 318 cd05570, STKc_PKC, Catalytic domain of the Protein 3e-08
cd05591 321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 3e-08
cd05592 316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 4e-08
cd00180 215 cd00180, PKc, Catalytic domain of Protein Kinases 4e-08
cd08529 256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 4e-08
cd08529 256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 5e-08
cd08215 258 cd08215, STKc_Nek, Catalytic domain of the Protein 6e-08
cd05587 324 cd05587, STKc_cPKC, Catalytic domain of the Protei 7e-08
cd05577 277 cd05577, STKc_GRK, Catalytic domain of the Protein 1e-07
cd05615 323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 1e-07
cd05588 329 cd05588, STKc_aPKC, Catalytic domain of the Protei 2e-07
cd06605 265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 4e-07
cd05616 323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 6e-07
cd05591 321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 7e-07
cd05588 329 cd05588, STKc_aPKC, Catalytic domain of the Protei 8e-07
cd05592 316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 9e-07
COG0515 384 COG0515, SPS1, Serine/threonine protein kinase [Ge 9e-07
cd06623 264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 1e-06
cd05618 329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 1e-06
COG0515 384 COG0515, SPS1, Serine/threonine protein kinase [Ge 2e-06
cd05606 278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 2e-06
cd05615 323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 3e-06
cd05618 329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 3e-06
cd05590 320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 6e-06
cd05587 324 cd05587, STKc_cPKC, Catalytic domain of the Protei 6e-06
cd08217 265 cd08217, STKc_Nek2, Catalytic domain of the Protei 6e-06
cd05619 316 cd05619, STKc_nPKC_theta, Catalytic domain of the 7e-06
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 1e-05
PTZ00426 340 PTZ00426, PTZ00426, cAMP-dependent protein kinase 1e-05
cd06605 265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 2e-05
cd05577 277 cd05577, STKc_GRK, Catalytic domain of the Protein 3e-05
cd05633 279 cd05633, STKc_GRK3, Catalytic domain of the Protei 3e-05
cd05605 285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 3e-05
cd06606 260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 3e-05
cd05608 280 cd05608, STKc_GRK1, Catalytic domain of the Protei 4e-05
cd05617 327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 4e-05
cd05606 278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 5e-05
cd05617 327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 5e-05
cd05631 285 cd05631, STKc_GRK4, Catalytic domain of the Protei 5e-05
cd08217 265 cd08217, STKc_Nek2, Catalytic domain of the Protei 6e-05
cd05607 277 cd05607, STKc_GRK7, Catalytic domain of the Protei 6e-05
cd05616 323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 1e-04
cd05632 285 cd05632, STKc_GRK5, Catalytic domain of the Protei 1e-04
cd08219 255 cd08219, STKc_Nek3, Catalytic domain of the Protei 1e-04
cd05633 279 cd05633, STKc_GRK3, Catalytic domain of the Protei 2e-04
cd06606 260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 2e-04
cd05630 285 cd05630, STKc_GRK6, Catalytic domain of the Protei 2e-04
PTZ00426 340 PTZ00426, PTZ00426, cAMP-dependent protein kinase 3e-04
cd05605 285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 3e-04
cd05620 316 cd05620, STKc_nPKC_delta, Catalytic domain of the 3e-04
cd05619 316 cd05619, STKc_nPKC_theta, Catalytic domain of the 5e-04
cd08224 267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 6e-04
cd05632 285 cd05632, STKc_GRK5, Catalytic domain of the Protei 7e-04
cd08530 256 cd08530, STKc_CNK2-like, Catalytic domain of the P 7e-04
cd05122 253 cd05122, PKc_STE, Catalytic domain of STE family P 7e-04
cd05620 316 cd05620, STKc_nPKC_delta, Catalytic domain of the 8e-04
cd06611 280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 8e-04
cd05631 285 cd05631, STKc_GRK4, Catalytic domain of the Protei 0.001
cd05630 285 cd05630, STKc_GRK6, Catalytic domain of the Protei 0.001
cd06608 275 cd06608, STKc_myosinIII_like, Catalytic domain of 0.001
cd06627 254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 0.001
cd07830 283 cd07830, STKc_MAK_like, Catalytic domain of Male g 0.001
cd06609 274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 0.002
cd06609 274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 0.002
cd08220 256 cd08220, STKc_Nek8, Catalytic domain of the Protei 0.002
cd06612 256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 0.002
cd06612 256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 0.002
cd06643 282 cd06643, STKc_SLK, Catalytic domain of the Protein 0.002
cd06644 292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 0.002
cd07866 311 cd07866, STKc_BUR1, Catalytic domain of the Serine 0.002
cd06611 280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 0.003
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
 Score =  146 bits (371), Expect = 1e-43
 Identities = 54/64 (84%), Positives = 60/64 (93%)

Query: 76  VIGRGVFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVAHVRAERDVLVEADHQWVVKMY 135
           VIGRG FGEVRLVQKKDTGH+YAMK LRK++MLEKEQVAHVRAERD+L EAD+ WVVK+Y
Sbjct: 8   VIGRGAFGEVRLVQKKDTGHIYAMKKLRKSEMLEKEQVAHVRAERDILAEADNPWVVKLY 67

Query: 136 YSFQ 139
           YSFQ
Sbjct: 68  YSFQ 71


Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related (NDR) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. NDR kinases regulate mitosis, cell growth, embryonic development, and neurological processes. They are also required for proper centrosome duplication. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. This subfamily also contains fungal NDR-like kinases. Length = 364

>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 141
KOG0605|consensus 550 99.89
KOG0598|consensus 357 99.85
KOG0595|consensus 429 99.84
KOG0575|consensus 592 99.82
KOG0580|consensus 281 99.78
KOG0616|consensus 355 99.78
KOG4236|consensus 888 99.75
KOG0615|consensus 475 99.74
KOG0610|consensus 459 99.72
KOG0592|consensus 604 99.72
KOG0694|consensus 694 99.72
KOG0600|consensus 560 99.7
KOG0611|consensus 668 99.69
KOG0690|consensus 516 99.69
KOG0585|consensus 576 99.69
KOG0597|consensus 808 99.69
KOG0032|consensus 382 99.65
PTZ00263 329 protein kinase A catalytic subunit; Provisional 99.65
cd05626 381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.65
cd05598 376 STKc_LATS Catalytic domain of the Protein Serine/T 99.64
cd05599 364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.64
cd05628 363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.64
cd05629 377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.63
KOG0581|consensus 364 99.63
cd05625 382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.63
cd05612 291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.61
cd05597 331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.61
KOG0588|consensus 786 99.6
KOG0593|consensus 396 99.6
KOG0586|consensus 596 99.6
KOG0583|consensus 370 99.6
cd05627 360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.6
cd05624 331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.59
KOG0591|consensus 375 99.59
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.58
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 99.58
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.58
KOG0579|consensus 1187 99.56
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.56
KOG0198|consensus 313 99.55
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.54
cd05623 332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.54
cd05601 330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.54
KOG0589|consensus 426 99.53
cd05573 350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.53
KOG0659|consensus 318 99.53
KOG0612|consensus 1317 99.52
cd05631 285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.52
cd05571 323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.52
KOG0582|consensus 516 99.51
cd07871 288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.5
KOG0033|consensus 355 99.5
KOG0663|consensus 419 99.5
cd05595 323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.49
cd07859 338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.49
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.49
cd05585 312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.48
cd05593 328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.48
KOG0695|consensus 593 99.48
cd05605 285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.48
KOG0608|consensus 1034 99.48
cd05587 324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.48
cd07869 303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.47
KOG0986|consensus 591 99.47
cd05589 324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.46
KOG0660|consensus 359 99.46
cd06649 331 PKc_MEK2 Catalytic domain of the dual-specificity 99.46
cd05580 290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.46
cd07848 287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.45
cd05594 325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.45
KOG0201|consensus 467 99.44
cd05615 323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.44
cd05588 329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.43
cd07853 372 STKc_NLK Catalytic domain of the Serine/Threonine 99.43
KOG4717|consensus 864 99.43
cd05616 323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.43
KOG1152|consensus772 99.43
PLN00034 353 mitogen-activated protein kinase kinase; Provision 99.43
cd05632 285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.42
cd05578 258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.42
cd05630 285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.42
cd07872 309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.41
KOG0194|consensus 474 99.41
cd08228 267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.41
cd05618 329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.41
cd05570 318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.41
cd05603 321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.41
cd05608 280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.41
KOG0661|consensus 538 99.41
KOG4250|consensus 732 99.41
PHA03212 391 serine/threonine kinase US3; Provisional 99.4
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.4
cd06650 333 PKc_MEK1 Catalytic domain of the dual-specificity 99.39
cd05064 266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.39
cd05590 320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.38
cd05607 277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.38
cd05591 321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.38
PF00069 260 Pkinase: Protein kinase domain Protein kinase; unc 99.38
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.38
cd05617 327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.38
PRK09188 365 serine/threonine protein kinase; Provisional 99.37
cd05604 325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.37
cd05609 305 STKc_MAST Catalytic domain of the Protein Serine/T 99.37
cd06644 292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.36
cd08219 255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.36
cd05575 323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.36
cd05592 316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.36
cd05582 318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.35
cd05620 316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.35
cd05584 323 STKc_p70S6K Catalytic domain of the Protein Serine 99.35
cd07873 301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.35
cd06646 267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.35
cd08229 267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.35
KOG0578|consensus 550 99.35
PTZ00036 440 glycogen synthase kinase; Provisional 99.35
cd05586 330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.35
cd06611 280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.35
KOG0598|consensus 357 99.34
cd05614 332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.34
cd06615 308 PKc_MEK Catalytic domain of the dual-specificity P 99.34
cd05619 316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.34
cd06652 265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.34
cd05581 280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.34
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.34
cd05108 316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.34
cd05102 338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.34
PTZ00283 496 serine/threonine protein kinase; Provisional 99.33
cd05088 303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.33
cd07861 285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.33
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.33
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.33
cd05602 325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.33
cd08224 267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.33
cd06625 263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.32
cd05066 267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.32
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.32
PLN00009 294 cyclin-dependent kinase A; Provisional 99.32
cd06622 286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.32
cd05104 375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.32
cd05033 266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.31
cd06619 279 PKc_MKK5 Catalytic domain of the dual-specificity 99.31
KOG0574|consensus 502 99.31
KOG0594|consensus 323 99.31
cd08227 327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.31
KOG0577|consensus 948 99.31
cd06620 284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.3
cd05065 269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.3
cd06630 268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.3
cd05114 256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.3
cd06607 307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.3
cd07844 291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.3
cd05081 284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.3
cd07847 286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.29
cd08223 257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.29
cd05574 316 STKc_phototropin_like Catalytic domain of Phototro 99.29
cd08220 256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.29
cd07862 290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.29
cd05096 304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.29
cd07832 286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.28
cd06645 267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.28
KOG0192|consensus 362 99.28
cd08221 256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.28
cd08217 265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.28
cd06651 266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.28
cd05105 400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.28
cd08529 256 STKc_FA2-like Catalytic domain of the Protein Seri 99.28
cd07860 284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.28
cd06613 262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.27
cd06641 277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.27
PTZ00267 478 NIMA-related protein kinase; Provisional 99.27
cd06629 272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.27
cd07855 334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.27
cd07863 288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.27
cd06635 317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.27
cd07846 286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.27
cd07850 353 STKc_JNK Catalytic domain of the Serine/Threonine 99.26
KOG0605|consensus 550 99.26
cd08218 256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.26
cd06653 264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.26
cd06621 287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.26
cd06643 282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.26
cd07870 291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.26
cd06610 267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.26
cd05084 252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.25
cd07858 337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.25
cd07849 336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.25
cd05109 279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.25
cd07833 288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.25
cd07845 309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.24
cd07839 284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.24
cd05106 374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.24
cd05107 401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.24
cd05577 277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.24
cd05090 283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.23
cd06626 264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.23
cd07865 310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.23
cd05063 268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.23
PTZ00284 467 protein kinase; Provisional 99.23
cd07877 345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.23
cd07864 302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.23
cd08225 257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.22
cd07856 328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.22
cd05111 279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.22
cd05057 279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.22
cd06605 265 PKc_MAPKK Catalytic domain of the dual-specificity 99.22
cd06631 265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.22
cd06617 283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.21
PHA03209 357 serine/threonine kinase US3; Provisional 99.21
cd05113 256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.21
cd06642 277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.21
cd05046 275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.21
cd06640 277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.21
KOG0696|consensus 683 99.21
cd05079 284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.21
cd06623 264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.21
cd07836 284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.2
cd07841 298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.2
KOG0667|consensus 586 99.2
cd06609 274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.2
cd05067 260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.19
cd05103 343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.19
cd06654 296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.19
cd06633 313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.19
cd06656 297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.19
cd05055 302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.19
cd07866 311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.19
KOG0576|consensus 829 99.19
cd06647 293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.19
cd06612 256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.19
cd07880 343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.18
cd07843 293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.18
cd05059 256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.18
cd06628 267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.18
KOG0607|consensus 463 99.18
cd07837 295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.18
cd07854 342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.18
cd05056 270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.18
cd06634 308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.18
PHA03211 461 serine/threonine kinase US3; Provisional 99.18
cd07868 317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.17
cd05579 265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.17
cd06624 268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.17
cd05572 262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.17
cd07842 316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.17
cd06632 258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.17
KOG1035|consensus 1351 99.17
cd05072 261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.16
cd05048 283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.16
cd06627 254 STKc_Cdc7_like Catalytic domain of Cell division c 99.16
cd06655 296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.16
cd05051 296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.16
KOG0662|consensus 292 99.16
cd05122 253 PKc_STE Catalytic domain of STE family Protein Kin 99.15
cd05110 303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.15
cd07835 283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.15
cd05039 256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.14
cd08215 258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.14
cd05052 263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.14
cd07840 287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.14
cd06917 277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.13
cd05075 272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.13
cd05036 277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.13
cd05060 257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.13
cd05080 283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.13
cd05049 280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.13
KOG0193|consensus 678 99.13
cd05097 295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.12
KOG1989|consensus 738 99.12
cd07857 332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.12
cd05148 261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.12
cd06638 286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.12
cd05038 284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.12
KOG0587|consensus 953 99.12
cd05071 262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.12
cd05035 273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.11
KOG1187|consensus 361 99.11
cd06616 288 PKc_MKK4 Catalytic domain of the dual-specificity 99.11
KOG0197|consensus 468 99.11
cd05613 290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.11
KOG0614|consensus 732 99.11
cd06606 260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.11
PF07714 259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.11
cd06636 282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.11
cd07852 337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.11
smart00219 258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.11
cd06659 297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.11
cd06637 272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.11
PHA03207 392 serine/threonine kinase US3; Provisional 99.11
cd05098 307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.11
cd05068 261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.1
cd06658 292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.1
cd05123 250 STKc_AGC Catalytic domain of AGC family Protein Se 99.1
cd05032 277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.1
cd05054 337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.1
cd07834 330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.1
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.09
cd05112 256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.09
cd05076 274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.09
cd05041 251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.09
cd05053 293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.09
cd05078 258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.09
cd05101 304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.09
cd05115 257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.09
cd06639 291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.09
cd05070 260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.08
cd05050 288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.08
cd05633 279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.08
cd05611 260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.08
cd07851 343 STKc_p38 Catalytic domain of the Serine/Threonine 99.08
cd05085 250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.08
cd05034 261 PTKc_Src_like Catalytic domain of Src kinase-like 99.08
cd05089 297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.08
cd05093 288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.07
cd05100 334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.07
cd05095 296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.07
cd05043 280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.07
cd05116 257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.07
cd05073 260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.07
PTZ00024 335 cyclin-dependent protein kinase; Provisional 99.06
cd05082 256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.06
cd05583 288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.06
cd08530 256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.06
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.05
cd05092 280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.05
cd07831 282 STKc_MOK Catalytic domain of the Serine/Threonine 99.05
cd06608 275 STKc_myosinIII_like Catalytic domain of Class III 99.05
cd07867 317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.05
KOG1151|consensus 775 99.05
cd08226 328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.04
cd06618 296 PKc_MKK7 Catalytic domain of the dual-specificity 99.04
PHA02988 283 hypothetical protein; Provisional 99.04
cd05069 260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.04
PHA03210 501 serine/threonine kinase US3; Provisional 99.03
cd07830 283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.03
cd05091 283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.03
cd05606 278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.03
cd05061 288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.03
KOG2345|consensus 302 99.03
cd05037 259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.03
cd00192 262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.03
cd07838 287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.03
cd05118 283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.02
cd07829 282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.02
cd05083 254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.01
cd05074 273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.01
cd05062 277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.0
cd05094 291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.0
cd06614 286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.0
cd05045 290 PTKc_RET Catalytic domain of the Protein Tyrosine 98.99
cd07879 342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 98.99
cd05099 314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 98.99
cd05040 257 PTKc_Ack_like Catalytic domain of the Protein Tyro 98.98
KOG0666|consensus 438 98.98
KOG0575|consensus 592 98.98
cd06657 292 STKc_PAK4 Catalytic domain of the Protein Serine/T 98.97
KOG0616|consensus 355 98.97
cd08222 260 STKc_Nek11 Catalytic domain of the Protein Serine/ 98.97
cd05077 262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 98.96
cd05058 262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 98.96
cd05087 269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 98.96
KOG4257|consensus 974 98.95
cd05042 269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 98.95
KOG1095|consensus 1025 98.95
KOG0658|consensus 364 98.94
cd06648 285 STKc_PAK_II Catalytic domain of the Protein Serine 98.93
cd08528 269 STKc_Nek10 Catalytic domain of the Protein Serine/ 98.91
KOG1026|consensus 774 98.91
KOG4645|consensus 1509 98.91
KOG1094|consensus 807 98.91
KOG0615|consensus 475 98.9
cd05047 270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 98.88
smart00090237 RIO RIO-like kinase. 98.88
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.86
KOG0592|consensus 604 98.84
KOG0610|consensus 459 98.84
cd05044 269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 98.84
KOG4279|consensus 1226 98.83
KOG2052|consensus 513 98.83
KOG0580|consensus 281 98.81
KOG0599|consensus 411 98.81
PHA03390 267 pk1 serine/threonine-protein kinase 1; Provisional 98.8
KOG0581|consensus 364 98.77
KOG1006|consensus 361 98.75
KOG0611|consensus 668 98.75
KOG0984|consensus 282 98.75
PHA02882 294 putative serine/threonine kinase; Provisional 98.74
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 98.74
KOG0668|consensus 338 98.73
KOG0591|consensus 375 98.73
KOG0690|consensus 516 98.73
cd08216 314 PK_STRAD Pseudokinase domain of STE20-related kina 98.72
KOG0595|consensus 429 98.7
cd05086 268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 98.7
KOG0694|consensus 694 98.69
KOG0584|consensus 632 98.68
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 98.68
PRK10345210 hypothetical protein; Provisional 98.68
KOG0199|consensus 1039 98.68
KOG1035|consensus 1351 98.67
KOG0596|consensus 677 98.65
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 98.64
KOG4278|consensus 1157 98.62
KOG0983|consensus 391 98.61
KOG0032|consensus 382 98.58
cd05576 237 STKc_RPK118_like Catalytic domain of the Protein S 98.57
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 98.56
KOG0196|consensus 996 98.55
KOG0585|consensus 576 98.55
KOG0608|consensus 1034 98.54
cd05626 381 STKc_LATS2 Catalytic domain of the Protein Serine/ 98.52
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 98.52
KOG0600|consensus 560 98.51
KOG1290|consensus 590 98.47
KOG0597|consensus 808 98.47
cd05599 364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 98.47
cd05625 382 STKc_LATS1 Catalytic domain of the Protein Serine/ 98.46
KOG3653|consensus 534 98.46
PTZ00263 329 protein kinase A catalytic subunit; Provisional 98.46
PLN03224 507 probable serine/threonine protein kinase; Provisio 98.46
KOG0584|consensus 632 98.44
cd05629 377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 98.42
KOG0603|consensus 612 98.42
cd05571 323 STKc_PKB Catalytic domain of the Protein Serine/Th 98.39
cd05628 363 STKc_NDR1 Catalytic domain of the Protein Serine/T 98.39
KOG1164|consensus 322 98.39
KOG4721|consensus 904 98.39
cd05595 323 STKc_PKB_beta Catalytic domain of the Protein Seri 98.39
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 98.38
cd05598 376 STKc_LATS Catalytic domain of the Protein Serine/T 98.36
cd05593 328 STKc_PKB_gamma Catalytic domain of the Protein Ser 98.35
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 98.34
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 98.33
cd05627 360 STKc_NDR2 Catalytic domain of the Protein Serine/T 98.32
cd05585 312 STKc_YPK1_like Catalytic domain of Yeast Protein K 98.32
KOG1345|consensus 378 98.3
KOG1025|consensus 1177 98.3
KOG0612|consensus 1317 98.29
PRK14879211 serine/threonine protein kinase; Provisional 98.28
KOG0664|consensus 449 98.28
KOG0658|consensus 364 98.28
KOG0604|consensus 400 98.25
KOG0670|consensus 752 98.25
cd05612 291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 98.25
KOG0033|consensus 355 98.25
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 98.25
KOG0661|consensus 538 98.24
KOG0986|consensus 591 98.23
smart00220 244 S_TKc Serine/Threonine protein kinases, catalytic 98.23
cd05594 325 STKc_PKB_alpha Catalytic domain of the Protein Ser 98.21
cd05588 329 STKc_aPKC Catalytic domain of the Protein Serine/T 98.21
cd05605 285 STKc_GRK4_like Catalytic domain of G protein-coupl 98.21
cd05597 331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 98.2
KOG4236|consensus 888 98.2
KOG1163|consensus 341 98.2
cd05608 280 STKc_GRK1 Catalytic domain of the Protein Serine/T 98.2
cd06607 307 STKc_TAO Catalytic domain of the Protein Serine/Th 98.2
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 98.19
cd05631 285 STKc_GRK4 Catalytic domain of the Protein Serine/T 98.19
cd05607 277 STKc_GRK7 Catalytic domain of the Protein Serine/T 98.19
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 98.19
KOG0577|consensus 948 98.17
cd08228 267 STKc_Nek6 Catalytic domain of the Protein Serine/T 98.15
cd05618 329 STKc_aPKC_iota Catalytic domain of the Protein Ser 98.14
KOG0586|consensus 596 98.14
PLN00034 353 mitogen-activated protein kinase kinase; Provision 98.14
KOG0593|consensus 396 98.14
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 98.14
KOG0659|consensus 318 98.11
cd07871 288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 98.1
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 98.1
KOG0669|consensus 376 98.1
cd05601 330 STKc_CRIK Catalytic domain of the Protein Serine/T 98.07
cd06633 313 STKc_TAO3 Catalytic domain of the Protein Serine/T 98.07
KOG0200|consensus 609 98.06
cd05578 258 STKc_Yank1 Catalytic domain of the Protein Serine/ 98.06
KOG1187|consensus 361 98.06
cd05624 331 STKc_MRCK_beta Catalytic domain of the Protein Ser 98.06
PRK09605535 bifunctional UGMP family protein/serine/threonine 98.06
KOG1166|consensus 974 98.06
KOG4250|consensus 732 98.06
cd05573 350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 98.06
KOG0194|consensus 474 98.05
KOG0695|consensus 593 98.04
cd05570 318 STKc_PKC Catalytic domain of the Protein Serine/Th 98.03
cd05632 285 STKc_GRK5 Catalytic domain of the Protein Serine/T 98.03
cd05617 327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 98.03
KOG0671|consensus 415 98.03
cd05630 285 STKc_GRK6 Catalytic domain of the Protein Serine/T 98.03
cd07869 303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 98.02
cd05603 321 STKc_SGK2 Catalytic domain of the Protein Serine/T 98.01
cd05591 321 STKc_nPKC_epsilon Catalytic domain of the Protein 98.01
KOG0614|consensus 732 98.01
cd05590 320 STKc_nPKC_eta Catalytic domain of the Protein Seri 98.0
cd05604 325 STKc_SGK3 Catalytic domain of the Protein Serine/T 98.0
PRK12274218 serine/threonine protein kinase; Provisional 98.0
KOG0192|consensus 362 98.0
KOG1167|consensus 418 97.99
KOG0198|consensus 313 97.99
cd06619 279 PKc_MKK5 Catalytic domain of the dual-specificity 97.99
cd08229 267 STKc_Nek7 Catalytic domain of the Protein Serine/T 97.99
>KOG0605|consensus Back     alignment and domain information
Probab=99.89  E-value=1.5e-22  Score=137.27  Aligned_cols=130  Identities=48%  Similarity=0.743  Sum_probs=113.0

Q ss_pred             hhhhccccCCCCccceeeecccCCCceeEEEEEecCCCCeeeeeeecchhhhhHHHHHHHHHHHHHHhhccccceecc-c
Q psy5212           2 EFLRLKRSRLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVAHVRAERDVLVEADHQWVIGR-G   80 (141)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~~ig~G~~g~v~~~~~~~~~~~~a~K~~~~~~~~~~~~~~~~~~e~~il~~~~~~~ii~~-~   80 (141)
                      +|.+.++.+++++||+++..||+||||.||+|+.+.||..+|+|++.++.+....++.+++.|.++|...++|++|.. +
T Consensus       129 e~lR~~R~r~~~~DFe~Lk~IgkGAfGeVrLarKk~Tg~iyAmK~LkKS~M~~~~Qv~hV~aERdiL~~~ds~~vVKLyY  208 (550)
T KOG0605|consen  129 EYLRLRRTRLSLDDFELLKVIGKGAFGEVRLARKKDTGEIYAMKILKKSEMLKKNQVEHVRAERDILAEVDSPWVVKLYY  208 (550)
T ss_pred             HHHHhccccCCcccchhheeeccccceeEEEEEEccCCcEEeeecccHHHHHhhhhHHHHHHHHHHhhhcCCCcEEEEEE
Confidence            688999999999999999999999999999999999999999999999999999999999999999999999999996 6


Q ss_pred             cc---eeEEEEEecCCCcchHhhhhhhhccccHHHHHHHHHHHHHHHhc-CCceee
Q psy5212          81 VF---GEVRLVQKKDTGHVYAMKILRKADMLEKEQVAHVRAERDVLVEA-DHQWVV  132 (141)
Q Consensus        81 ~~---~~v~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~e~~~l~~l-~h~~iv  132 (141)
                      +|   ..+|++|++.+|+.+ +-++...+.+.+...+.+..|..++... |.-+++
T Consensus       209 sFQD~~~LYLiMEylPGGD~-mTLL~~~~~L~e~~arfYiaE~vlAI~~iH~~gyI  263 (550)
T KOG0605|consen  209 SFQDKEYLYLIMEYLPGGDM-MTLLMRKDTLTEDWARFYIAETVLAIESIHQLGYI  263 (550)
T ss_pred             EecCCCeeEEEEEecCCccH-HHHHHhcCcCchHHHHHHHHHHHHHHHHHHHcCcc
Confidence            66   379999999999975 4445555667888899999998775543 333443



>KOG0598|consensus Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>KOG1152|consensus Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>KOG0662|consensus Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG1989|consensus Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>KOG0587|consensus Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>KOG1151|consensus Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>KOG2345|consensus Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>KOG0666|consensus Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>KOG4257|consensus Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>KOG1095|consensus Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>KOG4645|consensus Back     alignment and domain information
>KOG1094|consensus Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>KOG2052|consensus Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>KOG1006|consensus Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>KOG0984|consensus Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG0668|consensus Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>KOG0584|consensus Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>KOG0596|consensus Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG0983|consensus Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>KOG1290|consensus Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>KOG3653|consensus Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0584|consensus Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>KOG1164|consensus Back     alignment and domain information
>KOG4721|consensus Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG1345|consensus Back     alignment and domain information
>KOG1025|consensus Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0664|consensus Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>KOG0670|consensus Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>KOG1163|consensus Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>KOG0669|consensus Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>KOG0200|consensus Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>KOG1166|consensus Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>KOG0671|consensus Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>KOG1167|consensus Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
2vd5_A 412 Structure Of Human Myotonic Dystrophy Protein Kinas 2e-17
2vd5_A 412 Structure Of Human Myotonic Dystrophy Protein Kinas 6e-15
4aw2_A 437 Crystal Structure Of Cdc42 Binding Protein Kinase A 3e-17
4aw2_A 437 Crystal Structure Of Cdc42 Binding Protein Kinase A 1e-14
3tku_A 433 Mrck Beta In Complex With Fasudil Length = 433 1e-16
3tku_A 433 Mrck Beta In Complex With Fasudil Length = 433 3e-15
3qfv_A 415 Mrck Beta In Complex With Tpca-1 Length = 415 4e-16
3qfv_A 415 Mrck Beta In Complex With Tpca-1 Length = 415 2e-15
3v8s_A 410 Human Rho-Associated Protein Kinase 1 (Rock 1) In C 2e-13
3v8s_A 410 Human Rho-Associated Protein Kinase 1 (Rock 1) In C 3e-13
2esm_A 415 Crystal Structure Of Rock 1 Bound To Fasudil Length 2e-13
2esm_A 415 Crystal Structure Of Rock 1 Bound To Fasudil Length 3e-13
2v55_A 406 Mechanism Of Multi-site Phosphorylation From A Rock 2e-13
2v55_A 406 Mechanism Of Multi-site Phosphorylation From A Rock 3e-13
2f2u_A 402 Crystal Structure Of The Rho-Kinase Kinase Domain L 8e-12
2f2u_A 402 Crystal Structure Of The Rho-Kinase Kinase Domain L 1e-11
2z7q_A 321 Crystal Structure Of The N-Terminal Kinase Domain O 1e-11
1mrv_A 339 Crystal Structure Of An Inactive Akt2 Kinase Domain 3e-11
1mrv_A 339 Crystal Structure Of An Inactive Akt2 Kinase Domain 9e-11
4gv1_A 340 Pkb Alpha In Complex With Azd5363 Length = 340 6e-11
4gv1_A 340 Pkb Alpha In Complex With Azd5363 Length = 340 6e-11
3ocb_A 341 Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor 7e-11
3cqu_A 342 Crystal Structure Of Akt-1 Complexed With Substrate 7e-11
1gzn_A 335 Structure Of Pkb Kinase Domain Length = 335 9e-11
4ejn_A 446 Crystal Structure Of Autoinhibited Form Of Akt1 In 9e-11
3o96_A 446 Crystal Structure Of Human Akt1 With An Allosteric 9e-11
1gzk_A 315 Molecular Mechanism For The Regulation Of Protein K 9e-11
3e87_A 335 Crystal Structures Of The Kinase Domain Of Akt2 In 9e-11
1o6k_A 336 Structure Of Activated Form Of Pkb Kinase Domain S4 1e-10
2jdo_A 342 Structure Of Pkb-Beta (Akt2) Complexed With Isoquin 1e-10
1o6l_A 337 Crystal Structure Of An Activated Akt/protein Kinas 1e-10
1vzo_A 355 The Structure Of The N-Terminal Kinase Domain Of Ms 2e-10
1vzo_A 355 The Structure Of The N-Terminal Kinase Domain Of Ms 2e-07
3g51_A 325 Structural Diversity Of The Active Conformation Of 4e-10
3ubd_A 304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 4e-10
4el9_A 305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 4e-10
4fr4_A 384 Crystal Structure Of Human SerineTHREONINE-Protein 2e-09
3a60_A 327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 4e-09
3a62_A 327 Crystal Structure Of Phosphorylated P70s6k1 Length 4e-09
1zrz_A 364 Crystal Structure Of The Catalytic Domain Of Atypic 9e-09
1zrz_A 364 Crystal Structure Of The Catalytic Domain Of Atypic 9e-06
1h1w_A 289 High Resolution Crystal Structure Of The Human Pdk1 1e-08
1z5m_A 286 Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr 1e-08
3nus_A 286 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra 1e-08
1uu9_A 286 Structure Of Human Pdk1 Kinase Domain In Complex Wi 1e-08
3txo_A 353 Pkc Eta Kinase In Complex With A Naphthyridine Leng 1e-08
3txo_A 353 Pkc Eta Kinase In Complex With A Naphthyridine Leng 6e-07
3pwy_A 311 Crystal Structure Of An Extender (Spd28345)-Modifie 1e-08
3nun_A 292 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea 1e-08
3rwp_A 311 Discovery Of A Novel, Potent And Selective Inhibito 1e-08
3nax_A 311 Pdk1 In Complex With Inhibitor Mp7 Length = 311 1e-08
3iop_A 312 Pdk-1 In Complex With The Inhibitor Compound-8i Len 1e-08
2biy_A 310 Structure Of Pdk1-S241a Mutant Kinase Domain Length 1e-08
1uu3_A 310 Structure Of Human Pdk1 Kinase Domain In Complex Wi 1e-08
3qc4_A 314 Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 1e-08
3nay_A 311 Pdk1 In Complex With Inhibitor Mp6 Length = 311 1e-08
3h9o_A 311 Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) 1e-08
2r7b_A 312 Crystal Structure Of The Phosphoinositide-Dependent 1e-08
4a07_A 311 Human Pdk1 Kinase Domain In Complex With Allosteric 1e-08
2xch_A 309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 1e-08
3sc1_A 311 Novel Isoquinolone Pdk1 Inhibitors Discovered Throu 1e-08
3hrc_A 311 Crystal Structure Of A Mutant Of Human Pdk1 Kinase 1e-08
4dc2_A 396 Structure Of Pkc In Complex With A Substrate Peptid 2e-08
4dc2_A 396 Structure Of Pkc In Complex With A Substrate Peptid 2e-05
3orx_A 316 Pdk1 Mutant Bound To Allosteric Disulfide Fragment 2e-08
3zh8_A 349 A Novel Small Molecule Apkc Inhibitor Length = 349 3e-08
3zh8_A 349 A Novel Small Molecule Apkc Inhibitor Length = 349 9e-06
3a8w_A 345 Crystal Structure Of Pkciota Kinase Domain Length = 3e-08
3a8w_A 345 Crystal Structure Of Pkciota Kinase Domain Length = 9e-06
2xck_A 309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 3e-08
1fot_A 318 Structure Of The Unliganded Camp-Dependent Protein 5e-08
1fot_A 318 Structure Of The Unliganded Camp-Dependent Protein 2e-07
2r5t_A 373 Crystal Structure Of Inactive Serum And Glucocortic 9e-08
1ctp_E 350 Structure Of The Mammalian Catalytic Subunit Of Cam 1e-07
3l9m_A 351 Crystal Structure Of Pkab3 (Pka Triple Mutant V123a 1e-07
3mvj_A 371 Human Cyclic Amp-Dependent Protein Kinase Pka Inhib 1e-07
3nx8_A 351 Human Camp Dependent Protein Kinase In Complex With 1e-07
4ae6_A 343 Structure And Function Of The Human Sperm-specific 1e-07
3agl_A 351 Complex Of Pka With The Bisubstrate Protein Kinase 1e-07
3agm_A 351 Complex Of Pka With The Bisubstrate Protein Kinase 1e-07
1cmk_E 350 Crystal Structures Of The Myristylated Catalytic Su 1e-07
4ae9_A 343 Structure And Function Of The Human Sperm-specific 1e-07
1cdk_A 350 Camp-Dependent Protein Kinase Catalytic Subunit (E. 1e-07
2gu8_A 337 Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel 2e-07
3pvb_A 345 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 2e-07
4dg3_E 371 Crystal Structure Of R336a Mutant Of Camp-dependent 2e-07
4dfy_A 371 Crystal Structure Of R194a Mutant Of Camp-Dependent 2e-07
3o7l_B 350 Crystal Structure Of Phospholamban (1-19):pka C-Sub 2e-07
4dfx_E 350 Crystal Structure Of Myristoylated K7c Catalytic Su 2e-07
1rdq_E 350 Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of 2e-07
2qur_A 350 Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe 2e-07
3qal_E 350 Crystal Structure Of Arg280ala Mutant Of Catalytic 2e-07
1jbp_E 350 Crystal Structure Of The Catalytic Subunit Of Camp- 2e-07
1syk_A 350 Crystal Structure Of E230q Mutant Of Camp-Dependent 2e-07
1l3r_E 350 Crystal Structure Of A Transition State Mimic Of Th 2e-07
2qcs_A 350 A Complex Structure Between The Catalytic And Regul 2e-07
1bkx_A 350 A Binary Complex Of The Catalytic Subunit Of Camp-D 2e-07
2erz_E 351 Crystal Structure Of C-amp Dependent Kinase (pka) B 2e-07
1fmo_E 350 Crystal Structure Of A Polyhistidine-Tagged Recombi 2e-07
3fhi_A 350 Crystal Structure Of A Complex Between The Catalyti 2e-07
3qam_E 350 Crystal Structure Of Glu208ala Mutant Of Catalytic 2e-07
1j3h_A 350 Crystal Structure Of Apoenzyme Camp-Dependent Prote 2e-07
1apm_E 350 2.0 Angstrom Refined Crystal Structure Of The Catal 2e-07
2gnj_A 350 Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 3e-07
2gng_A 350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 3e-07
2gnf_A 350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 3e-07
3pfq_A 674 Crystal Structure And Allosteric Activation Of Prot 3e-07
3pfq_A 674 Crystal Structure And Allosteric Activation Of Prot 1e-04
1xh7_A 350 Crystal Structures Of Protein Kinase B Selective In 5e-07
2jds_A 351 Structure Of Camp-Dependent Protein Kinase Complexe 5e-07
1q8w_A 350 The Catalytic Subunit Of Camp-Dependent Protein Kin 5e-07
2f7e_E 351 Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu 5e-07
1stc_E 350 Camp-Dependent Protein Kinase, Alpha-Catalytic Subu 5e-07
2c1a_A 351 Structure Of Camp-Dependent Protein Kinase Complexe 5e-07
1svh_A 350 Crystal Structure Of Protein Kinase A In Complex Wi 5e-07
1szm_A 350 Dual Binding Mode Of Bisindolylmaleimide 2 To Prote 6e-07
3dnd_A 350 Camp-Dependent Protein Kinase Pka Catalytic Subunit 6e-07
1q61_A 350 Pka Triple Mutant Model Of Pkb Length = 350 6e-07
2uzt_A 336 Pka Structures Of Akt, Indazole-Pyridine Inhibitors 6e-07
1q24_A 350 Pka Double Mutant Model Of Pkb In Complex With Mgat 6e-07
1ydt_E 350 Structure Of Camp-Dependent Protein Kinase, Alpha-C 6e-07
3ama_A 351 Protein Kinase A Sixfold Mutant Model Of Aurora B W 7e-07
2vo0_A 351 Structure Of Pka-Pkb Chimera Complexed With C-(4-(4 1e-06
2uvy_A 351 Structure Of Pka-pkb Chimera Complexed With Methyl- 1e-06
2jdt_A 351 Structure Of Pka-Pkb Chimera Complexed With Isoquin 1e-06
1smh_A 350 Protein Kinase A Variant Complex With Completely Or 2e-06
1xh9_A 350 Crystal Structures Of Protein Kinase B Selective In 2e-06
2i0e_A 353 Structure Of Catalytic Domain Of Human Protein Kina 2e-06
2i0e_A 353 Structure Of Catalytic Domain Of Human Protein Kina 9e-05
3cik_A 689 Human Grk2 In Complex With Gbetagamma Subunits Leng 1e-05
3krw_A 688 Human Grk2 In Complex With Gbetgamma Subunits And B 1e-05
3iw4_A 360 Crystal Structure Of Pkc Alpha In Complex With Nvp- 1e-05
3iw4_A 360 Crystal Structure Of Pkc Alpha In Complex With Nvp- 4e-05
1omw_A 689 Crystal Structure Of The Complex Between G Protein- 1e-05
3psc_A 695 Bovine Grk2 In Complex With Gbetagamma Subunits Len 1e-05
2jed_A 352 The Crystal Structure Of The Kinase Domain Of The P 4e-05
2jed_A 352 The Crystal Structure Of The Kinase Domain Of The P 2e-04
3i79_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 2e-04
3ku2_A 507 Crystal Structure Of Inactivated Form Of Cdpk1 From 2e-04
3hx4_A 508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 2e-04
1xjd_A 345 Crystal Structure Of Pkc-Theta Complexed With Staur 2e-04
3ma6_A 298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 2e-04
3dxn_A 287 Crystal Structure Of The Calcium-dependent Kinase F 3e-04
3hzt_A 467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 3e-04
3i7c_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 4e-04
2bfy_A 284 Complex Of Aurora-B With Incenp And Hesperidin. Len 6e-04
2w1d_A 275 Structure Determination Of Aurora Kinase In Complex 6e-04
2w1c_A 275 Structure Determination Of Aurora Kinase In Complex 6e-04
2xng_A 283 Structure Of Aurora-A Bound To A Selective Imidazop 6e-04
2xne_A 272 Structure Of Aurora-A Bound To An Imidazopyrazine I 6e-04
3coh_A 268 Crystal Structure Of Aurora-A In Complex With A Pen 6e-04
3unz_A 279 Aurora A In Complex With Rpm1679 Length = 279 7e-04
3fdn_A 279 Structure-Based Drug Design Of Novel Aurora Kinase 7e-04
2x6d_A 285 Aurora-A Bound To An Inhibitor Length = 285 7e-04
1ol6_A 282 Structure Of Unphosphorylated D274n Mutant Of Auror 7e-04
1ol5_A 282 Structure Of Aurora-A 122-403, Phosphorylated On Th 7e-04
2c6e_A 283 Aurora A Kinase Activated Mutant (T287d) In Complex 7e-04
1muo_A 297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 7e-04
3qbn_A 281 Structure Of Human Aurora A In Complex With A Diami 7e-04
2wtw_A 285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 7e-04
2wtv_A 285 Aurora-A Inhibitor Structure Length = 285 7e-04
2c6d_A 275 Aurora A Kinase Activated Mutant (T287d) In Complex 7e-04
2dwb_A 285 Aurora-A Kinase Complexed With Amppnp Length = 285 7e-04
2bmc_A 306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 8e-04
2j4z_A 306 Structure Of Aurora-2 In Complex With Pha-680626 Le 8e-04
>pdb|2VD5|A Chain A, Structure Of Human Myotonic Dystrophy Protein Kinase In Complex With The Bisindoylmaleide Inhibitor Bim Viii Length = 412 Back     alignment and structure

Iteration: 1

Score = 84.3 bits (207), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 43/73 (58%), Positives = 54/73 (73%) Query: 4 LRLKRSRLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVAHVRA 63 +RLK RL +DFE LKVIGRGAF EV +V+ K TG VYAMKI+ K DML++ +V+ R Sbjct: 51 VRLKEVRLQRDDFEILKVIGRGAFSEVAVVKMKQTGQVYAMKIMNKWDMLKRGEVSCFRE 110 Query: 64 ERDVLVEADHQWV 76 ERDVLV D +W+ Sbjct: 111 ERDVLVNGDRRWI 123
>pdb|2VD5|A Chain A, Structure Of Human Myotonic Dystrophy Protein Kinase In Complex With The Bisindoylmaleide Inhibitor Bim Viii Length = 412 Back     alignment and structure
>pdb|4AW2|A Chain A, Crystal Structure Of Cdc42 Binding Protein Kinase Alpha (Mrck Alpha) Length = 437 Back     alignment and structure
>pdb|4AW2|A Chain A, Crystal Structure Of Cdc42 Binding Protein Kinase Alpha (Mrck Alpha) Length = 437 Back     alignment and structure
>pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 Back     alignment and structure
>pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 Back     alignment and structure
>pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 Back     alignment and structure
>pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 Back     alignment and structure
>pdb|3V8S|A Chain A, Human Rho-Associated Protein Kinase 1 (Rock 1) In Complex With Indazole Derivative (Compound 18) Length = 410 Back     alignment and structure
>pdb|3V8S|A Chain A, Human Rho-Associated Protein Kinase 1 (Rock 1) In Complex With Indazole Derivative (Compound 18) Length = 410 Back     alignment and structure
>pdb|2ESM|A Chain A, Crystal Structure Of Rock 1 Bound To Fasudil Length = 415 Back     alignment and structure
>pdb|2ESM|A Chain A, Crystal Structure Of Rock 1 Bound To Fasudil Length = 415 Back     alignment and structure
>pdb|2V55|A Chain A, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 406 Back     alignment and structure
>pdb|2V55|A Chain A, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 406 Back     alignment and structure
>pdb|2F2U|A Chain A, Crystal Structure Of The Rho-Kinase Kinase Domain Length = 402 Back     alignment and structure
>pdb|2F2U|A Chain A, Crystal Structure Of The Rho-Kinase Kinase Domain Length = 402 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 Back     alignment and structure
>pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 Back     alignment and structure
>pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 Back     alignment and structure
>pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|4FR4|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase 32a (Yank1) Length = 384 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|1ZRZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Atypical Protein Kinase C-Iota Length = 364 Back     alignment and structure
>pdb|1ZRZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Atypical Protein Kinase C-Iota Length = 364 Back     alignment and structure
>pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 Back     alignment and structure
>pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 Back     alignment and structure
>pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 Back     alignment and structure
>pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 Back     alignment and structure
>pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 Back     alignment and structure
>pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 Back     alignment and structure
>pdb|3PWY|A Chain A, Crystal Structure Of An Extender (Spd28345)-Modified Human Pdk1 Complex 2 Length = 311 Back     alignment and structure
>pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 Back     alignment and structure
>pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 Back     alignment and structure
>pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 Back     alignment and structure
>pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 Back     alignment and structure
>pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 Back     alignment and structure
>pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 Back     alignment and structure
>pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 Back     alignment and structure
>pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 Back     alignment and structure
>pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 Back     alignment and structure
>pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 Back     alignment and structure
>pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 Back     alignment and structure
>pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 Back     alignment and structure
>pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 Back     alignment and structure
>pdb|4DC2|A Chain A, Structure Of Pkc In Complex With A Substrate Peptide From Par-3 Length = 396 Back     alignment and structure
>pdb|4DC2|A Chain A, Structure Of Pkc In Complex With A Substrate Peptide From Par-3 Length = 396 Back     alignment and structure
>pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 Back     alignment and structure
>pdb|3ZH8|A Chain A, A Novel Small Molecule Apkc Inhibitor Length = 349 Back     alignment and structure
>pdb|3ZH8|A Chain A, A Novel Small Molecule Apkc Inhibitor Length = 349 Back     alignment and structure
>pdb|3A8W|A Chain A, Crystal Structure Of Pkciota Kinase Domain Length = 345 Back     alignment and structure
>pdb|3A8W|A Chain A, Crystal Structure Of Pkciota Kinase Domain Length = 345 Back     alignment and structure
>pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 Back     alignment and structure
>pdb|1CTP|E Chain E, Structure Of The Mammalian Catalytic Subunit Of Camp-Dependent Protein Kinase And An Inhibitor Peptide Displays An Open Conformation Length = 350 Back     alignment and structure
>pdb|3L9M|A Chain A, Crystal Structure Of Pkab3 (Pka Triple Mutant V123a, L173m, Q181k) With Compound 18 Length = 351 Back     alignment and structure
>pdb|3MVJ|A Chain A, Human Cyclic Amp-Dependent Protein Kinase Pka Inhibitor Complex Length = 371 Back     alignment and structure
>pdb|3NX8|A Chain A, Human Camp Dependent Protein Kinase In Complex With Phenol Length = 351 Back     alignment and structure
>pdb|4AE6|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit Calpha 2 Length = 343 Back     alignment and structure
>pdb|3AGL|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-1039 Length = 351 Back     alignment and structure
>pdb|3AGM|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-670 Length = 351 Back     alignment and structure
>pdb|1CMK|E Chain E, Crystal Structures Of The Myristylated Catalytic Subunit Of Camp- Dependent Protein Kinase Reveal Open And Closed Conformations Length = 350 Back     alignment and structure
>pdb|4AE9|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit C Alpha 2 Length = 343 Back     alignment and structure
>pdb|1CDK|A Chain A, Camp-Dependent Protein Kinase Catalytic Subunit (E.C.2.7.1.37) (Protein Kinase A) Complexed With Protein Kinase Inhibitor Peptide Fragment 5-24 (Pki(5-24) Isoelectric Variant Ca) And Mn2+ Adenylyl Imidodiphosphate (Mnamp-Pnp) At Ph 5.6 And 7c And 4c Length = 350 Back     alignment and structure
>pdb|2GU8|A Chain A, Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel And Potent Inhibitors For Akt: Synthesis And Sar Studies Length = 337 Back     alignment and structure
>pdb|3PVB|A Chain A, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 345 Back     alignment and structure
>pdb|4DG3|E Chain E, Crystal Structure Of R336a Mutant Of Camp-dependent Protein Kinase With Unphosphorylated Turn Motif Length = 371 Back     alignment and structure
>pdb|4DFY|A Chain A, Crystal Structure Of R194a Mutant Of Camp-Dependent Protein Kinase With Unphosphorylated Activation Loop Length = 371 Back     alignment and structure
>pdb|3O7L|B Chain B, Crystal Structure Of Phospholamban (1-19):pka C-Subunit:amp-Pnp:mg2+ Complex Length = 350 Back     alignment and structure
>pdb|4DFX|E Chain E, Crystal Structure Of Myristoylated K7c Catalytic Subunit Of Camp- Dependent Protein Kinase In Complex With Sp20 And Amp-Pnp Length = 350 Back     alignment and structure
>pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|2QUR|A Chain A, Crystal Structure Of F327aK285P MUTANT OF CAMP-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3QAL|E Chain E, Crystal Structure Of Arg280ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1JBP|E Chain E, Crystal Structure Of The Catalytic Subunit Of Camp- Dependent Protein Kinase Complexed With A Substrate Peptide, Adp And Detergent Length = 350 Back     alignment and structure
>pdb|1SYK|A Chain A, Crystal Structure Of E230q Mutant Of Camp-Dependent Protein Kinase Reveals Unexpected Apoenzyme Conformation Length = 350 Back     alignment and structure
>pdb|1L3R|E Chain E, Crystal Structure Of A Transition State Mimic Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|2QCS|A Chain A, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 350 Back     alignment and structure
>pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic Subunit Of Camp-Dependent Protein Kinase And Adenosine Further Defines Conformational Flexibility Length = 350 Back     alignment and structure
>pdb|2ERZ|E Chain E, Crystal Structure Of C-amp Dependent Kinase (pka) Bound To Hydroxyfasudil Length = 351 Back     alignment and structure
>pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistidine-Tagged Recombinant Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With The Peptide Inhibitor Pki(5-24) And Adenosine Length = 350 Back     alignment and structure
>pdb|3FHI|A Chain A, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 350 Back     alignment and structure
>pdb|3QAM|E Chain E, Crystal Structure Of Glu208ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme Camp-Dependent Protein Kinase Catalytic Subunit Length = 350 Back     alignment and structure
>pdb|1APM|E Chain E, 2.0 Angstrom Refined Crystal Structure Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With A Peptide Inhibitor And Detergent Length = 350 Back     alignment and structure
>pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 Back     alignment and structure
>pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 Back     alignment and structure
>pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|1XH7|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|2JDS|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With A- 443654 Length = 351 Back     alignment and structure
>pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-Dependent Protein Kinase In Complex With Rho-Kinase Inhibitor Fasudil (Ha-1077) Length = 350 Back     alignment and structure
>pdb|2F7E|E Chain E, Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoquinolin-6- Yl-Pyridin-3-Yloxymethyl-Etylamine Length = 351 Back     alignment and structure
>pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With Staurosporine Length = 350 Back     alignment and structure
>pdb|2C1A|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With Isoquinoline-5-Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl)amide Length = 351 Back     alignment and structure
>pdb|1SVH|A Chain A, Crystal Structure Of Protein Kinase A In Complex With Azepane Derivative 8 Length = 350 Back     alignment and structure
>pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylmaleimide 2 To Protein Kinase A (Pka) Length = 350 Back     alignment and structure
>pdb|3DND|A Chain A, Camp-Dependent Protein Kinase Pka Catalytic Subunit With Pki-5-24 Length = 350 Back     alignment and structure
>pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb Length = 350 Back     alignment and structure
>pdb|2UZT|A Chain A, Pka Structures Of Akt, Indazole-Pyridine Inhibitors Length = 336 Back     alignment and structure
>pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb In Complex With Mgatp Length = 350 Back     alignment and structure
>pdb|1YDT|E Chain E, Structure Of Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With H89 Protein Kinase Inhibitor N-[2- (4-Bromocinnamylamino)ethyl]-5-Isoquinoline Length = 350 Back     alignment and structure
>pdb|3AMA|A Chain A, Protein Kinase A Sixfold Mutant Model Of Aurora B With Inhibitor Jnj- 7706621 Length = 351 Back     alignment and structure
>pdb|2VO0|A Chain A, Structure Of Pka-Pkb Chimera Complexed With C-(4-(4- Chlorophenyl)-1-(7h-Pyrrolo(2, 3-D)pyrimidin-4-Yl)piperidin- 4-Yl)methylamine Length = 351 Back     alignment and structure
>pdb|2UVY|A Chain A, Structure Of Pka-pkb Chimera Complexed With Methyl-(4-(9h- Purin-6-yl)-benzyl)-amine Length = 351 Back     alignment and structure
>pdb|2JDT|A Chain A, Structure Of Pka-Pkb Chimera Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 351 Back     alignment and structure
>pdb|1SMH|A Chain A, Protein Kinase A Variant Complex With Completely Ordered N- Terminal Helix Length = 350 Back     alignment and structure
>pdb|1XH9|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 Back     alignment and structure
>pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 Back     alignment and structure
>pdb|3CIK|A Chain A, Human Grk2 In Complex With Gbetagamma Subunits Length = 689 Back     alignment and structure
>pdb|3KRW|A Chain A, Human Grk2 In Complex With Gbetgamma Subunits And Balanol (Soak) Length = 688 Back     alignment and structure
>pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 Back     alignment and structure
>pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 Back     alignment and structure
>pdb|1OMW|A Chain A, Crystal Structure Of The Complex Between G Protein-Coupled Receptor Kinase 2 And Heterotrimeric G Protein Beta 1 And Gamma 2 Subunits Length = 689 Back     alignment and structure
>pdb|3PSC|A Chain A, Bovine Grk2 In Complex With Gbetagamma Subunits Length = 695 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 4e-36
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 3e-33
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 2e-34
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 2e-32
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 2e-34
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 7e-32
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 4e-27
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 2e-26
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 5e-27
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 1e-26
1uu3_A 310 HPDK1, 3-phosphoinositide dependent protein kinase 5e-27
1uu3_A 310 HPDK1, 3-phosphoinositide dependent protein kinase 3e-26
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 1e-26
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 8e-25
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 2e-26
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 6e-25
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 2e-26
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 1e-23
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 4e-26
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 1e-23
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 5e-26
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 2e-23
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 9e-26
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 6e-24
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 1e-25
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 4e-23
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 2e-25
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 8e-24
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 2e-25
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 5e-24
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 2e-25
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 1e-24
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 2e-25
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 3e-23
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 4e-25
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 5e-25
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 3e-22
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 1e-24
3g51_A 325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 5e-24
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 4e-23
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 2e-22
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 1e-16
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 2e-16
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 2e-16
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 2e-15
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 7e-16
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 1e-14
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 3e-15
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 2e-14
4apc_A 350 Serine/threonine-protein kinase NEK1; transferase; 5e-14
4apc_A 350 Serine/threonine-protein kinase NEK1; transferase; 7e-13
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 6e-14
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 2e-12
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 3e-13
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 6e-13
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 9e-13
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 3e-11
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 2e-12
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 5e-11
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 4e-12
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 1e-11
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 2e-11
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 1e-11
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 3e-11
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 1e-11
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 2e-11
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 2e-11
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 4e-11
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 2e-11
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 3e-11
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 2e-11
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 4e-11
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 2e-11
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 4e-11
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 2e-11
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 5e-11
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 2e-11
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 4e-11
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 3e-11
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 6e-09
3bhy_A 283 Death-associated protein kinase 3; death associate 5e-11
3bhy_A 283 Death-associated protein kinase 3; death associate 5e-11
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 5e-11
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 4e-10
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 5e-11
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 5e-11
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 5e-11
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 7e-11
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 6e-11
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 9e-11
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 6e-11
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 2e-09
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 6e-11
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 8e-11
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 7e-11
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 5e-10
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 7e-11
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 1e-10
2a19_B 284 Interferon-induced, double-stranded RNA-activated 1e-10
2a19_B 284 Interferon-induced, double-stranded RNA-activated 1e-08
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 2e-10
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 3e-10
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 2e-10
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 1e-08
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 2e-10
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 3e-10
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 2e-10
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 3e-10
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 3e-10
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 2e-09
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 3e-10
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 3e-10
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 3e-10
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 3e-10
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 4e-10
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 4e-10
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 5e-10
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 7e-10
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 5e-10
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 1e-09
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 2e-09
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 9e-09
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 2e-09
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 1e-08
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 2e-09
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 1e-08
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 3e-09
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 5e-09
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 4e-09
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 2e-07
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 4e-09
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 5e-08
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 4e-09
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 1e-08
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 4e-09
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 6e-08
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 5e-09
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 7e-09
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 8e-09
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 1e-08
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 1e-08
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 3e-08
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 1e-08
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 2e-06
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 1e-08
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 2e-08
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 1e-08
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 3e-08
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 1e-08
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 2e-07
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 2e-08
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 1e-07
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 3e-08
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 2e-07
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 4e-08
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 5e-08
3aln_A 327 Dual specificity mitogen-activated protein kinase; 6e-08
3aln_A 327 Dual specificity mitogen-activated protein kinase; 1e-05
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 6e-08
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 4e-07
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 7e-08
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 7e-08
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 1e-06
3fme_A 290 Dual specificity mitogen-activated protein kinase; 9e-08
3fme_A 290 Dual specificity mitogen-activated protein kinase; 6e-05
3an0_A 340 Dual specificity mitogen-activated protein kinase; 1e-07
3an0_A 340 Dual specificity mitogen-activated protein kinase; 5e-05
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 1e-07
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 8e-07
2dyl_A 318 Dual specificity mitogen-activated protein kinase 3e-07
2dyl_A 318 Dual specificity mitogen-activated protein kinase 6e-05
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 4e-07
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 2e-06
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 4e-07
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 9e-07
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 4e-07
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 1e-06
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 5e-07
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 1e-06
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 7e-07
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 1e-05
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 9e-07
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 4e-06
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 1e-06
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 5e-06
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 1e-06
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 3e-06
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 1e-06
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 9e-06
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 1e-06
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 3e-06
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 2e-06
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 8e-06
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 6e-06
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 8e-06
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 6e-06
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 1e-05
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 7e-06
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 1e-05
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 7e-06
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 3e-05
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 8e-06
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 1e-05
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 9e-06
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 7e-05
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 9e-06
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 3e-05
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 1e-05
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 1e-05
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 2e-05
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 6e-05
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 3e-05
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 7e-05
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 3e-05
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 5e-05
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 4e-05
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 2e-04
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 5e-05
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 2e-04
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 1e-04
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 2e-04
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 4e-04
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
 Score =  127 bits (320), Expect = 4e-36
 Identities = 43/77 (55%), Positives = 54/77 (70%)

Query: 2   EFLRLKRSRLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVAHV 61
             +RLK  RL  +DFE LKVIGRGAF EV +V+ K TG VYAMKI+ K DML++ +V+  
Sbjct: 49  IVVRLKEVRLQRDDFEILKVIGRGAFSEVAVVKMKQTGQVYAMKIMNKWDMLKRGEVSCF 108

Query: 62  RAERDVLVEADHQWVIG 78
           R ERDVLV  D +W+  
Sbjct: 109 REERDVLVNGDRRWITQ 125


>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query141
4aw0_A 311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.89
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 99.86
3hyh_A 275 Carbon catabolite-derepressing protein kinase; kin 99.86
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 99.83
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.82
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 99.81
4fie_A 423 Serine/threonine-protein kinase PAK 4; kinase doma 99.8
3fpq_A 290 Serine/threonine-protein kinase WNK1; protein seri 99.8
3ubd_A 304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.79
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.78
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 99.78
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.77
4asz_A 299 BDNF/NT-3 growth factors receptor; transferase, TR 99.76
3omv_A 307 RAF proto-oncogene serine/threonine-protein kinas; 99.75
4aoj_A 329 High affinity nerve growth factor receptor; transf 99.74
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 99.72
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.71
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.71
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 99.71
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.7
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 99.7
4gt4_A 308 Tyrosine-protein kinase transmembrane receptor RO; 99.69
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 99.69
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 99.68
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 99.68
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.66
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 99.66
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 99.65
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 99.65
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 99.65
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 99.65
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 99.64
4ase_A 353 Vascular endothelial growth factor receptor 2; tra 99.63
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 99.62
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 99.62
3rp9_A 458 Mitogen-activated protein kinase; structural genom 99.62
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.62
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.62
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.61
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.61
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.6
3o0g_A 292 Cell division protein kinase 5; kinase activator c 99.6
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 99.6
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.6
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 99.59
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.59
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 99.59
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 99.59
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 99.59
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 99.59
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 99.59
3hmm_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.58
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 99.58
3uqc_A 286 Probable conserved transmembrane protein; structur 99.58
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 99.58
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.58
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.58
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 99.57
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 99.57
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.57
3ork_A 311 Serine/threonine protein kinase; structural genomi 99.57
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 99.57
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.57
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 99.57
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.56
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 99.56
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.56
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.56
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 99.56
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.55
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 99.55
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 99.55
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 99.55
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 99.55
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 99.55
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 99.55
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.54
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.54
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.54
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.53
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 99.53
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 99.53
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 99.52
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 99.52
3niz_A 311 Rhodanese family protein; structural genomics, str 99.52
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 99.51
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 99.51
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 99.51
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.51
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 99.5
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 99.5
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 99.49
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.49
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 99.49
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 99.49
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 99.49
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.49
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 99.49
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 99.49
3bhy_A 283 Death-associated protein kinase 3; death associate 99.49
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 99.48
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.48
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.48
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 99.48
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 99.48
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.48
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 99.48
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 99.48
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 99.48
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 99.48
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 99.47
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.47
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.47
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.47
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 99.47
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 99.47
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.47
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 99.47
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.47
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 99.47
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 99.47
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 99.47
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 99.46
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 99.46
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 99.46
4hcu_A 269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.46
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.46
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 99.45
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.45
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 99.45
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 99.45
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 99.45
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 99.45
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 99.45
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.45
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 99.45
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.44
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 99.44
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 99.44
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 99.44
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 99.44
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.44
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 99.44
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.44
3fme_A 290 Dual specificity mitogen-activated protein kinase; 99.44
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 99.43
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 99.43
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.42
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.42
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.42
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.42
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.42
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.42
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 99.42
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.42
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 99.42
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.42
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 99.42
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.42
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 99.41
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.41
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.41
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.41
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.41
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 99.41
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.41
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 99.41
3soc_A 322 Activin receptor type-2A; structural genomics cons 99.41
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 99.41
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 99.4
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 99.4
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 99.4
2dyl_A 318 Dual specificity mitogen-activated protein kinase 99.4
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 99.4
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 99.4
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.4
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 99.39
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.39
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.39
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 99.39
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.39
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.39
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.39
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 99.39
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.38
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 99.38
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.38
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.37
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 99.37
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.37
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.37
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 99.37
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 99.37
2a19_B 284 Interferon-induced, double-stranded RNA-activated 99.37
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.36
3pls_A 298 Macrophage-stimulating protein receptor; protein k 99.36
3an0_A 340 Dual specificity mitogen-activated protein kinase; 99.36
3aln_A 327 Dual specificity mitogen-activated protein kinase; 99.36
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 99.36
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 99.35
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.35
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.35
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.34
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 99.34
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 99.34
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.34
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 99.33
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.33
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 99.33
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.33
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.33
3q4u_A 301 Activin receptor type-1; structural genomics conso 99.32
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.32
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 99.32
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.32
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.32
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 99.32
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 99.31
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.31
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.3
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 99.3
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 99.3
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 99.29
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 99.29
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.29
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 99.28
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.28
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 99.28
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 99.28
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.28
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.28
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.27
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 99.27
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 99.27
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.26
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 99.26
4hgt_A 296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.25
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 99.25
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 99.23
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.23
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 99.23
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 99.23
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 99.23
4aw0_A 311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.19
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.17
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 99.17
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.17
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 99.16
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.12
3hyh_A 275 Carbon catabolite-derepressing protein kinase; kin 99.11
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 99.08
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 99.05
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 99.01
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 99.01
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 98.97
3fpq_A 290 Serine/threonine-protein kinase WNK1; protein seri 98.97
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 98.97
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 98.92
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 98.9
4fie_A 423 Serine/threonine-protein kinase PAK 4; kinase doma 98.87
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 98.85
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 98.78
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 98.75
4aoj_A 329 High affinity nerve growth factor receptor; transf 98.71
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 98.68
4asz_A 299 BDNF/NT-3 growth factors receptor; transferase, TR 98.67
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 98.67
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 98.64
3ubd_A 304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 98.62
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 98.62
4gt4_A 308 Tyrosine-protein kinase transmembrane receptor RO; 98.61
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 98.58
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 98.55
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 98.54
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 98.53
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 98.53
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 98.51
4gyi_A 397 RIO2 kinase; protein kinase, ADP complex, phosphoa 98.5
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 98.49
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 98.49
3uqc_A 286 Probable conserved transmembrane protein; structur 98.48
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 98.47
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 98.46
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 98.45
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 98.45
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 98.44
3omv_A 307 RAF proto-oncogene serine/threonine-protein kinas; 98.43
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 98.43
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 98.43
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 98.42
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 98.4
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 98.4
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 98.39
3o0g_A 292 Cell division protein kinase 5; kinase activator c 98.39
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 98.36
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 98.36
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 98.35
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 98.35
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 98.34
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 98.34
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 98.33
3ork_A 311 Serine/threonine protein kinase; structural genomi 98.33
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 98.33
3rp9_A 458 Mitogen-activated protein kinase; structural genom 98.33
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 98.33
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 98.32
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 98.31
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 98.31
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 98.31
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 98.31
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 98.3
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 98.3
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 98.3
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 98.3
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 98.29
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 98.29
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 98.28
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 98.27
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 98.27
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 98.25
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 98.24
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 98.24
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 98.23
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 98.23
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 98.23
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 98.23
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 98.22
4ase_A 353 Vascular endothelial growth factor receptor 2; tra 98.22
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 98.22
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 98.21
3hmm_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 98.21
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 98.2
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 98.2
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 98.19
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 98.18
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 98.18
3niz_A 311 Rhodanese family protein; structural genomics, str 98.18
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 98.18
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 98.18
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 98.18
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 98.18
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 98.17
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 98.17
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 98.16
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 98.16
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 98.15
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 98.15
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 98.15
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 98.15
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 98.14
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 98.14
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 98.14
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 98.12
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 98.12
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 98.11
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 98.11
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 98.11
3bhy_A 283 Death-associated protein kinase 3; death associate 98.11
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 98.1
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 98.1
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 98.1
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 98.1
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 98.1
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 98.1
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 98.1
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 98.09
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 98.09
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 98.09
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 98.09
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 98.09
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 98.06
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 98.06
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 98.04
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 98.04
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 98.03
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 98.03
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 98.02
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 98.02
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 98.02
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 98.02
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 98.02
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 98.01
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 98.01
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 98.01
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 98.0
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 98.0
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 98.0
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 97.99
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 97.97
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 97.97
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 97.97
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 97.96
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 97.94
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 97.94
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 97.94
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 97.94
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 97.93
3pls_A 298 Macrophage-stimulating protein receptor; protein k 97.93
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 97.93
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 97.92
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 97.92
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 97.91
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 97.91
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 97.91
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 97.9
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 97.9
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 97.9
3fme_A 290 Dual specificity mitogen-activated protein kinase; 97.89
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 97.88
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 97.88
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 97.86
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 97.86
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 97.85
2dyl_A 318 Dual specificity mitogen-activated protein kinase 97.84
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 97.84
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 97.84
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 97.84
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 97.83
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 97.83
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 97.83
4hcu_A 269 Tyrosine-protein kinase ITK/TSK; transferase-trans 97.83
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 97.83
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 97.82
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 97.82
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 97.82
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 97.81
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 97.81
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 97.8
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 97.8
2a19_B 284 Interferon-induced, double-stranded RNA-activated 97.8
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 97.8
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 97.8
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 97.79
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 97.78
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 97.77
3aln_A 327 Dual specificity mitogen-activated protein kinase; 97.76
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 97.76
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 97.75
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 97.74
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 97.74
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 97.74
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 97.74
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 97.74
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 97.73
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 97.73
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 97.73
3soc_A 322 Activin receptor type-2A; structural genomics cons 97.73
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 97.73
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 97.71
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 97.71
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 97.68
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 97.67
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 97.67
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 97.66
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 97.64
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 97.64
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 97.64
3an0_A 340 Dual specificity mitogen-activated protein kinase; 97.64
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 97.62
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 97.59
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 97.58
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 97.58
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 97.57
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 97.56
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 97.55
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 97.54
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 97.54
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 97.52
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 97.52
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 97.5
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 97.49
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 97.48
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 97.46
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 97.45
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 97.43
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 97.41
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 97.38
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 97.38
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 97.37
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 97.34
3q4u_A 301 Activin receptor type-1; structural genomics conso 97.33
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 97.33
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 97.32
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 97.29
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 97.28
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 97.2
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 97.16
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 97.14
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 97.07
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 97.01
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 96.95
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 96.95
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 96.9
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 96.83
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 96.78
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 96.75
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 96.57
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 96.39
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 96.34
3en9_A 540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 96.26
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
Probab=99.89  E-value=5.9e-23  Score=134.74  Aligned_cols=124  Identities=25%  Similarity=0.345  Sum_probs=103.0

Q ss_pred             cCCCCccceeeecccCCCceeEEEEEecCCCCeeeeeeecchhhhhHHHHHHHHHHHHHHhhccccceecc-ccc---ee
Q psy5212           9 SRLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVAHVRAERDVLVEADHQWVIGR-GVF---GE   84 (141)
Q Consensus         9 ~~~~~~~~~~~~~ig~G~~g~v~~~~~~~~~~~~a~K~~~~~~~~~~~~~~~~~~e~~il~~~~~~~ii~~-~~~---~~   84 (141)
                      .+...++|++++.||+|+||.||+|+++.+++.+|+|++.+.........+.+.+|+.+++.++||||+.. +.|   ..
T Consensus        27 ~~~~~~dy~i~~~lG~G~fg~V~~a~~~~~~~~~AiK~i~k~~~~~~~~~~~~~~E~~il~~l~HpnIv~l~~~~~~~~~  106 (311)
T 4aw0_A           27 RKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEK  106 (311)
T ss_dssp             CCCCGGGEEEEEEEEEETTEEEEEEEETTTCCEEEEEEEEHHHHHHTTCHHHHHHHHHHHTTCCCTTBCCEEEEEECSSE
T ss_pred             CCCCccccEEEEEEecccCeEEEEEEECCCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHHHhCCCCCCCeEEEEEEeCCE
Confidence            34567899999999999999999999999999999999998777666677889999999999999999995 333   57


Q ss_pred             EEEEEecCCCcchHhhhhhhhccccHHHHHHHHHHHHH-HHhcCCceeee
Q psy5212          85 VRLVQKKDTGHVYAMKILRKADMLEKEQVAHVRAERDV-LVEADHQWVVK  133 (141)
Q Consensus        85 v~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~e~~~-l~~l~h~~iv~  133 (141)
                      +|++|+++.|+.+ .+.+.....+++.....+..++.. +..+|..+|+|
T Consensus       107 ~yivmEy~~gG~L-~~~i~~~~~l~e~~~~~~~~qi~~al~ylH~~~IiH  155 (311)
T 4aw0_A          107 LYFGLSYAKNGEL-LKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIH  155 (311)
T ss_dssp             EEEEECCCTTEEH-HHHHHHHSSCCHHHHHHHHHHHHHHHHHHHHTTEEC
T ss_pred             EEEEEecCCCCCH-HHHHHHcCCCCHHHHHHHHHHHHHHHHHHHHCCCcc
Confidence            9999999998754 445556666788888888888654 77777777775



>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 141
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 1e-17
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 1e-14
d1rdqe_ 350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 2e-16
d1rdqe_ 350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 3e-13
d1fota_ 316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 3e-16
d1fota_ 316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 6e-15
d1uu3a_ 288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 1e-15
d1uu3a_ 288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 1e-14
d2j4za1 263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 4e-15
d2j4za1 263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 5e-14
d1vzoa_ 322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 5e-15
d1vzoa_ 322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 2e-10
d2java1 269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 2e-14
d2java1 269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 2e-12
d1xjda_ 320 d.144.1.7 (A:) Protein kinase C, theta type {Human 2e-14
d1xjda_ 320 d.144.1.7 (A:) Protein kinase C, theta type {Human 7e-13
d1nvra_ 271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 4e-14
d1nvra_ 271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 7e-12
d1u5ra_ 309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 4e-14
d1u5ra_ 309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 3e-13
d1o6ya_ 277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 2e-13
d1o6ya_ 277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 6e-13
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 2e-13
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 1e-12
d3blha1 318 d.144.1.7 (A:8-325) Cell division protein kinase 9 4e-13
d3blha1 318 d.144.1.7 (A:8-325) Cell division protein kinase 9 5e-11
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 5e-13
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 8e-12
d1gz8a_ 298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 5e-13
d1gz8a_ 298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 2e-10
d1koba_ 352 d.144.1.7 (A:) Twitchin, kinase domain {California 7e-13
d1koba_ 352 d.144.1.7 (A:) Twitchin, kinase domain {California 2e-12
d1ua2a_ 299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 1e-12
d1ua2a_ 299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 6e-12
d1yhwa1 293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 2e-12
d1yhwa1 293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 1e-11
d2jfla1 288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 2e-12
d2jfla1 288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 9e-12
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 3e-12
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 6e-12
d1unla_ 292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 3e-12
d1unla_ 292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 7e-11
d1a06a_ 307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 3e-12
d1a06a_ 307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 3e-12
d2gfsa1 348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 4e-12
d2gfsa1 348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 5e-11
d2b1pa1 355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 4e-12
d2b1pa1 355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 3e-11
d1jksa_ 293 d.144.1.7 (A:) Death-associated protein kinase, Da 5e-12
d2ozaa1 335 d.144.1.7 (A:51-385) MAP kinase activated protein 2e-11
d2ozaa1 335 d.144.1.7 (A:51-385) MAP kinase activated protein 6e-11
d1opja_ 287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 2e-11
d1opja_ 287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 1e-10
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 2e-11
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 1e-10
d1cm8a_ 346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 3e-11
d1cm8a_ 346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 1e-10
d1tkia_ 321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 3e-11
d1tkia_ 321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 5e-11
d1phka_ 277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 4e-11
d1phka_ 277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 1e-08
d1u46a_ 273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 7e-11
d1u46a_ 273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 5e-09
d1t4ha_ 270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 9e-11
d1t4ha_ 270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 5e-09
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 1e-10
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 1e-09
d1xkka_ 317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 3e-10
d1xkka_ 317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 2e-08
d1fvra_ 309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 3e-10
d1fvra_ 309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 3e-09
d1ob3a_ 286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 4e-10
d1ob3a_ 286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 9e-09
d1k2pa_ 258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 5e-10
d1k2pa_ 258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 1e-08
d3bqca1 328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 9e-10
d3bqca1 328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 4e-08
d1xwsa_ 273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 1e-09
d1xwsa_ 273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 2e-09
d1q8ya_ 362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 3e-09
d1q8ya_ 362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 6e-08
d1blxa_ 305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 3e-09
d1blxa_ 305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 2e-07
d1u59a_ 285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 3e-09
d1u59a_ 285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 4e-08
d1fmka3 285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 7e-09
d1fmka3 285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 1e-07
d1byga_ 262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 8e-09
d1byga_ 262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 3e-07
d1sm2a_ 263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 9e-09
d1sm2a_ 263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 1e-07
d1qpca_ 272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 1e-08
d1qpca_ 272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 5e-07
d1xbba_ 277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 1e-08
d1xbba_ 277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 3e-08
d1jpaa_ 299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 2e-08
d1jpaa_ 299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 2e-08
d1lufa_ 301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 2e-08
d1lufa_ 301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 2e-06
d1csna_ 293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 3e-08
d1ckia_ 299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 4e-08
d1ckia_ 299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 4e-07
d1p4oa_ 308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 4e-08
d1p4oa_ 308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 3e-07
d1uwha_ 276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 1e-07
d1uwha_ 276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 2e-06
d1mqba_ 283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 1e-07
d1mqba_ 283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 5e-07
d1t46a_ 311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 1e-07
d1t46a_ 311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 3e-07
d1r0pa_ 311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 2e-07
d1r0pa_ 311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 4e-07
d1ywna1 299 d.144.1.7 (A:818-1166) Vascular endothelial growth 3e-07
d1ywna1 299 d.144.1.7 (A:818-1166) Vascular endothelial growth 1e-05
d1mp8a_ 273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 3e-07
d1mp8a_ 273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 3e-06
d1rjba_ 325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 2e-06
d1rjba_ 325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 2e-05
d1fgka_ 299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 2e-06
d1fgka_ 299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 5e-05
d1vjya_ 303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 1e-05
d1vjya_ 303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 4e-05
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Pkb kinase (Akt-2)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 75.2 bits (184), Expect = 1e-17
 Identities = 30/68 (44%), Positives = 46/68 (67%)

Query: 10 RLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVAHVRAERDVLV 69
          ++ + DF+ LK++G+G FG+V LV++K TG  YAMKILRK  ++ K++VAH   E  VL 
Sbjct: 1  KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQ 60

Query: 70 EADHQWVI 77
             H ++ 
Sbjct: 61 NTRHPFLT 68


>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query141
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.86
d2j4za1 263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.85
d1uu3a_ 288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.85
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.84
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.83
d1nvra_ 271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.82
d1gz8a_ 298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.81
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.81
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.81
d2java1 269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.81
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 99.8
d1jksa_ 293 Death-associated protein kinase, Dap {Human (Homo 99.8
d1u5ra_ 309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.8
d2jfla1 288 STE20-like serine/threonine-protein kinase, SLK {H 99.8
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.8
d1o6ya_ 277 Mycobacterial protein kinase PknB, catalytic domai 99.79
d1yhwa1 293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1xjda_ 320 Protein kinase C, theta type {Human (Homo sapiens) 99.79
d1a06a_ 307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.79
d1opja_ 287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.78
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 99.78
d1phka_ 277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.76
d1t4ha_ 270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.76
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.75
d1unla_ 292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.74
d1k2pa_ 258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.74
d1ob3a_ 286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.73
d1jpaa_ 299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.73
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.73
d1xwsa_ 273 Proto-oncogene serine/threonine-protein kinase Pim 99.72
d1u59a_ 285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.72
d1u46a_ 273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.71
d1uwha_ 276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1xkka_ 317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.71
d1mqba_ 283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.7
d1sm2a_ 263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.7
d1ua2a_ 299 Cell division protein kinase 7, CDK7 {Human (Homo 99.7
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.7
d1mp8a_ 273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.69
d1qpca_ 272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.68
d3blha1 318 Cell division protein kinase 9, CDK9 {Human (Homo 99.68
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.68
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.68
d1fvra_ 309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1vzoa_ 322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.67
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.67
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.66
d1fmka3 285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.66
d1blxa_ 305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.65
d1xbba_ 277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.65
d1byga_ 262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.64
d1rjba_ 325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.64
d1r0pa_ 311 Hepatocyte growth factor receptor, c-MET {Human (H 99.6
d1t46a_ 311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.59
d1lufa_ 301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.59
d1fgka_ 299 Fibroblast growth factor receptor 1 {Human (Homo s 99.58
d1p4oa_ 308 Insulin-like growth factor 1 receptor {Human (Homo 99.56
d1ckia_ 299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.56
d1csna_ 293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.54
d1ywna1 299 Vascular endothelial growth factor receptor 2 (kdr 99.5
d1vjya_ 303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.46
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.44
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.14
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.09
d1u5ra_ 309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.06
d1uu3a_ 288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.04
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.04
d2j4za1 263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.04
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 98.97
d2java1 269 Serine/threonine-protein kinase Nek2 {Human (Homo 98.94
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 98.93
d1gz8a_ 298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 98.92
d1jksa_ 293 Death-associated protein kinase, Dap {Human (Homo 98.92
d1t4ha_ 270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 98.89
d1o6ya_ 277 Mycobacterial protein kinase PknB, catalytic domai 98.88
d1nvra_ 271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 98.88
d1yhwa1 293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 98.87
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 98.87
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 98.87
d1ua2a_ 299 Cell division protein kinase 7, CDK7 {Human (Homo 98.86
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 98.85
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 98.85
d1unla_ 292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 98.84
d1a06a_ 307 Calmodulin-dependent protein kinase {Rat (Rattus n 98.83
d2jfla1 288 STE20-like serine/threonine-protein kinase, SLK {H 98.83
d1opja_ 287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 98.82
d1ob3a_ 286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 98.79
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 98.77
d1phka_ 277 gamma-subunit of glycogen phosphorylase kinase (Ph 98.77
d1xjda_ 320 Protein kinase C, theta type {Human (Homo sapiens) 98.76
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 98.7
d1jpaa_ 299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 98.7
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 98.68
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 98.67
d1mqba_ 283 epha2 receptor tyrosine kinase {Human (Homo sapien 98.66
d1u46a_ 273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 98.64
d1xbba_ 277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 98.61
d1fvra_ 309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 98.61
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 98.6
d1u59a_ 285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 98.6
d3blha1 318 Cell division protein kinase 9, CDK9 {Human (Homo 98.59
d1xkka_ 317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 98.56
d1k2pa_ 258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 98.52
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 98.5
d1sm2a_ 263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 98.48
d1qpca_ 272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 98.44
d1mp8a_ 273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 98.43
d1xwsa_ 273 Proto-oncogene serine/threonine-protein kinase Pim 98.42
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 98.4
d1fmka3 285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 98.39
d1uwha_ 276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 98.38
d1byga_ 262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 98.37
d1lufa_ 301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 98.36
d1r0pa_ 311 Hepatocyte growth factor receptor, c-MET {Human (H 98.33
d1rjba_ 325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 98.3
d1p4oa_ 308 Insulin-like growth factor 1 receptor {Human (Homo 98.27
d1blxa_ 305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 98.25
d1t46a_ 311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 98.25
d1vzoa_ 322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 98.22
d1fgka_ 299 Fibroblast growth factor receptor 1 {Human (Homo s 98.0
d1vjya_ 303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 97.95
d1ywna1 299 Vascular endothelial growth factor receptor 2 (kdr 97.51
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 97.5
d1ckia_ 299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 97.36
d1csna_ 293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 97.35
d1zara2 191 Rio2 serine protein kinase C-terminal domain {Arch 95.34
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Pkb kinase (Akt-2)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.86  E-value=7.6e-22  Score=129.65  Aligned_cols=123  Identities=33%  Similarity=0.474  Sum_probs=101.7

Q ss_pred             CCCCccceeeecccCCCceeEEEEEecCCCCeeeeeeecchhhhhHHHHHHHHHHHHHHhhccccceecc-ccc---eeE
Q psy5212          10 RLGVEDFEPLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVAHVRAERDVLVEADHQWVIGR-GVF---GEV   85 (141)
Q Consensus        10 ~~~~~~~~~~~~ig~G~~g~v~~~~~~~~~~~~a~K~~~~~~~~~~~~~~~~~~e~~il~~~~~~~ii~~-~~~---~~v   85 (141)
                      ++++++|++++.||+|+||.||+|+++.+++.+|+|++.+...........+.+|+.+|+.++||||+.. +.+   ..+
T Consensus         1 ~i~l~dy~~~~~lG~G~fg~V~~~~~~~~~~~~AiK~i~k~~~~~~~~~~~~~~E~~il~~l~hp~Iv~l~~~~~~~~~~   80 (337)
T d1o6la_           1 KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRL   80 (337)
T ss_dssp             CCCGGGEEEEEEEEECSSEEEEEEEETTTCCEEEEEEEEHHHHHHTTCHHHHHHHHHHHHSCCCTTBCCEEEEEECSSEE
T ss_pred             CCchHhcEEEEEEecCcCeEEEEEEECCCCCEEEEEEEchhhccCHHHHHHHHHHHHHHHhCCCCCEEEEEeeecccccc
Confidence            4789999999999999999999999999999999999998776566667889999999999999999995 333   479


Q ss_pred             EEEEecCCCcchHhhhhhhhccccHHHHHHHHHHHHH-HHhcCCceeee
Q psy5212          86 RLVQKKDTGHVYAMKILRKADMLEKEQVAHVRAERDV-LVEADHQWVVK  133 (141)
Q Consensus        86 ~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~e~~~-l~~l~h~~iv~  133 (141)
                      |+++++..|+.+ ...+.....+.+...+.+..++.. +..+|..+|+|
T Consensus        81 ~iv~ey~~gg~L-~~~~~~~~~~~e~~~~~~~~qil~al~ylH~~~iiH  128 (337)
T d1o6la_          81 CFVMEYANGGEL-FFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVY  128 (337)
T ss_dssp             EEEEECCTTCBH-HHHHHHHSCCCHHHHHHHHHHHHHHHHHHHHTTCBC
T ss_pred             ccceeccCCCch-hhhhhcccCCcHHHHHHHHHHHhhhhhhhhhcCccc
Confidence            999999988864 445666667788888888777644 77777666664



>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure