Diaphorina citri psyllid: psy5221


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430------
MLSLLGINYFFYKIGLNIKILTISSIIFGFTGSIISLLLSKKIAKWSMNLMVIKNPSNFTEDWLLKTVNKISKNANISTPEVAIYNGEINAFATGAFKNSSLIAISANLLESMTKLEIKAIIAHEISHISNGDMVTMLLIQGVINTFIILISRIFSYILDCFLLNSYDDSNYNSNYNHKIYGLITTILQIFLGFGASIVVAWFSRNREFRADHGSAKLLGTPDPMISALRHLSNISIVNDLPKSIAILGINNNFKKKSFLKLFATHPSFEKRIAILSLLKLSLYFIRRSKMTVSAFAPFYRSTIGFDRLAQIFDNVRTEAQQSYPPYNIELVDENKYRITMAIAGFNRSDLEIETERDTLRITGRKQADTQQRNFLHRGIATRNFEHRFQLADHVHVVAAFFDQGILNIDLIREVPEALKPRKIYINTTKNTDRIE
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccccccHHHHHHHHHHHHHHcccccccEEEEcccccccccccccccCEEEEcHHHHHHccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcccccccccccccccccccccccccHHHHHccccccHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHccccccccccEEEcccccEEEEEEEcccccccccEEEEccEEEEEEEcccccccccEEHHHccccccccccccccEEEEcccccccccEEEEEEccccccccccEEEEcccccccccc
MLSLLGINYFFYKIGLNIKILTISSIIFGFTGSIISLLLSKKIAKWSMNLMVIKNPSNFTEDWLLKTVNKISKNANISTPEVAIYNGEINAFATGAFKNSSLIAISANLLESMTKLEIKAIIAHEISHISNGDMVTMLLIQGVINTFIILISRIFSYILDCFLLNSYD****NSNYNHKIYGLITTILQIFLGFGASIVVAWFSRNREFRADHGSAKLLGTPDPMISALRHLSNISIVNDLPKSIAILGINNNFKKKSFLKLFATHPSFEKRIAILSLLKLSL**********SAFAPFYRSTIGFDRLAQIFDNVRTEAQQSYPPYNIELVDENKYRITMAIAGFNRSDLEIETERDTLRIT********QRNFLHRGIATRNFEHRFQLADHVHVVAAFFDQGILNIDLIREVPEALKPRKIYIN*********
xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSLLGINYFFYKIGLNIKILTISSIIFGFTGSIISLLLSKKIAKWSMNLMVIKNPSNFTEDWLLKTVNKISKNANISTPEVAIYNGEINAFATGAFKNSSLIAISANLLESMTKLEIKAIIAHEISHISNGDMVTMLLIQGVINTFIILISRIFSYILDCFLLNSYDDSNYNSNYNHKIYGLITTILQIFLGFGASIVVAWFSRNREFRADHGSAKLLGTPDPMISALRHLSNISIVNDLPKSIAILGINNNFKKKSFLKLFATHPSFEKRIAILSLLKLSLYFIRRSKMTVSAFAPFYRSTIGFDRLAQIFDNVRTEAQQSYPPYNIELVDENKYRITMAIAGFNRSDLEIETERDTLRITGRKQADTQQRNFLHRGIATRNFEHRFQLADHVHVVAAFFDQGILNIDLIREVPEALKPRKIYINTTKNTDRIE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protease HtpX homolog confidentA6SXH1
Protease HtpX homolog confidentA1VSW7
Protease HtpX homolog confidentC5CML1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009279 [CC]cell outer membraneprobableGO:0044462, GO:0016020, GO:0044464, GO:0019867, GO:0030313, GO:0030312, GO:0005575, GO:0071944, GO:0005623, GO:0031975

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AW6, chain A
Confidence level:very confident
Coverage over the Query: 25-243,257-279
View the alignment between query and template
View the model in PyMOL
Template: 4ELD, chain A
Confidence level:very confident
Coverage over the Query: 323-427
View the alignment between query and template
View the model in PyMOL