Diaphorina citri psyllid: psy5241


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MEQAQFDVILCLSVTKWFHLNWGDSGIKRVFMRMYAQLREGGVLILEPQGFQSYKKKRKLTDTIWRNFQAIEFFPHHFTEYLLSEVGFTKCETLGSPLHPSKGFQRPIKMFTKGSKRDSRSGKEINPSGEWT
ccccccEEEEEEEEEEEEEECcccHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHcccHHHHccccccccccHHHHHHHHHccccCEEEEccccccccccccccEEEEEcccccccccccccccccccc
***AQFDVILCLSVTKWFHLNWGDSGIKRVFMRMYAQLREGGVLILEPQGFQSYKKKRKLTDTIWRNFQAIEFFPHHFTEYLLSEVGFTKCETLGSP*****GFQRPIKM**********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEQAQFDVILCLSVTKWFHLNWGDSGIKRVFMRMYAQLREGGVLILEPQGFQSYKKKRKLTDTIWRNFQAIEFFPHHFTEYLLSEVGFTKCETLGSPLHPSKGFQRPIKMFTKGSKRDSRSGKEINPSGEWT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable RNA methyltransferase CG1239 Probable methyltransferase.confidentQ9VNH1
7SK snRNA methylphosphate capping enzyme S-adenosyl-L-methionine-dependent methyltransferase that adds a methylphosphate cap at the 5'-end of 7SK snRNA, leading to stabilize it.confidentQ7L2J0
Probable RNA methyltransferase Y17G7B.18 Probable methyltransferase.confidentQ9U2R0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001510 [BP]RNA methylationprobableGO:0016070, GO:0006139, GO:0043170, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0009451, GO:0090304, GO:0071704, GO:0043412, GO:0006807, GO:0043414, GO:0008152, GO:0008150, GO:0032259, GO:1901360, GO:0046483
GO:0008173 [MF]RNA methyltransferase activityprobableGO:0008168, GO:0016740, GO:0016741, GO:0003674, GO:0003824
GO:0040031 [BP]snRNA modificationprobableGO:0016070, GO:0006139, GO:0016073, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0009451, GO:0090304, GO:0071704, GO:0043412, GO:0006807, GO:0008150, GO:0008152, GO:0034660, GO:0043170, GO:1901360, GO:0046483
GO:0050789 [BP]regulation of biological processprobableGO:0008150, GO:0065007
GO:0017069 [MF]snRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0008757 [MF]S-adenosylmethionine-dependent methyltransferase activityprobableGO:0008168, GO:0016740, GO:0016741, GO:0003674, GO:0003824

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3G07, chain A
Confidence level:very confident
Coverage over the Query: 2-94,106-115
View the alignment between query and template
View the model in PyMOL