Psyllid ID: psy5241

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MEQAQFDVILCLSVTKWFHLNWGDSGIKRVFMRMYAQLREGGVLILEPQGFQSYKKKRKLTDTIWRNFQAIEFFPHHFTEYLLSEVGFTKCETLGSPLHPSKGFQRPIKMFTKGSKRDSRSGKEINPSGEWT
ccccccEEEEEEEEEEEEEEEcccHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHcccHHHHccccccccccHHHHHHHHHccccEEEEEccccccccccccccEEEEEcccccccccccccccccccc
cccccccEEEEEEEHHEEEEccccHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHccccEEEEEccccccccccccEEEEEEEccccccccccccccccccc
MEQAQFDVILCLSVTKwfhlnwgdsGIKRVFMRMYAQLREGgvlilepqgfqsykkkRKLTDTIWRNFQAIEFFPHHFTEYLlsevgftkcetlgsplhpskgfqrpikmftkgskrdsrsgkeinpsgewt
MEQAQFDVILCLSVTKWFHLNWGDSGIKRVFMRMYAQLREGGvlilepqgfqsykKKRKLTDTIWRNFQAIEFFPHHFTEYLLSEVGFTKCETLGsplhpskgfqrpikmftkgskrdsrsgkeinpsgewt
MEQAQFDVILCLSVTKWFHLNWGDSGIKRVFMRMYAQLREGGVLILEPQGFQSYKKKRKLTDTIWRNFQAIEFFPHHFTEYLLSEVGFTKCETLGSPLHPSKGFQRPIKMFTKGSKRDSRSGKEINPSGEWT
*****FDVILCLSVTKWFHLNWGDSGIKRVFMRMYAQLREGGVLILEPQGFQSYKKKRKLTDTIWRNFQAIEFFPHHFTEYLLSEVGFTKCETLG*************************************
***AQFDVILCLSVTKWFHLNWGDSGIKRVFMRMYAQLREGGVLILEPQGFQSYKKKRKLTDTIWRNFQAIEFFPHHFTEYLLSEVGFTKCETLGSP*****GFQRPIKM**********************
MEQAQFDVILCLSVTKWFHLNWGDSGIKRVFMRMYAQLREGGVLILEPQGFQSYKKKRKLTDTIWRNFQAIEFFPHHFTEYLLSEVGFTKCETLGSPLHPSKGFQRPIKMFTK*******************
***AQFDVILCLSVTKWFHLNWGDSGIKRVFMRMYAQLREGGVLILEPQGFQSYKKKRKLTDTIWRNFQAIEFFPHHFTEYLLSEVGFTKCETLGSPLHPSKGFQRPIKMFTKGS*****************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEQAQFDVILCLSVTKWFHLNWGDSGIKRVFMRMYAQLREGGVLILEPQGFQSYKKKRKLTDTIWRNFQAIEFFPHHFTEYLLSEVGFTKCETLGSPLHPSKGFQRPIKMFTKGSKRDSRSGKEINPSGEWT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query132 2.2.26 [Sep-21-2011]
Q9VNH1300 Probable RNA methyltransf yes N/A 0.856 0.376 0.614 2e-35
Q7K480 1367 Probable RNA methyltransf no N/A 0.856 0.082 0.596 5e-35
A3KQ55645 7SK snRNA methylphosphate no N/A 0.848 0.173 0.526 3e-32
Q7L2J0689 7SK snRNA methylphosphate yes N/A 0.856 0.164 0.508 1e-31
Q8K3A9666 7SK snRNA methylphosphate yes N/A 0.856 0.169 0.5 2e-31
Q9U2R0378 Probable RNA methyltransf yes N/A 0.856 0.298 0.530 1e-29
Q6NPC9318 Probable RNA methyltransf yes N/A 0.856 0.355 0.429 3e-23
Q9Y7L2268 Probable RNA methyltransf yes N/A 0.636 0.313 0.411 1e-10
Q9VZD2238 Probable RNA methyltransf no N/A 0.469 0.260 0.380 5e-05
Q7T0L7255 Pre-miRNA 5'-monophosphat N/A N/A 0.515 0.266 0.333 5e-05
>sp|Q9VNH1|BN3D2_DROME Probable RNA methyltransferase CG1239 OS=Drosophila melanogaster GN=CG1239 PE=2 SV=2 Back     alignment and function desciption
 Score =  147 bits (372), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 88/114 (77%), Gaps = 1/114 (0%)

Query: 1   MEQAQFDVILCLSVTKWFHLNWGDSGIKRVFMRMYAQLREGGVLILEPQGFQSYKKKRKL 60
           +E+ QFDVILCLSVTKW HLN+ DSG+K+ F RMY QLR GG LILEPQ F  YK+++KL
Sbjct: 186 IERPQFDVILCLSVTKWIHLNFCDSGLKQAFRRMYLQLRPGGKLILEPQSFDGYKRRKKL 245

Query: 61  TDTIWRNFQAIEFFPHHFTEYLLS-EVGFTKCETLGSPLHPSKGFQRPIKMFTK 113
           ++ I  N+ AI+F P HFTEYLLS EVGF + + +G P H   GF+RPI++FTK
Sbjct: 246 SEQIRDNYNAIKFRPDHFTEYLLSPEVGFAEMKLMGIPEHCKVGFKRPIQIFTK 299
Probable methyltransferase.
Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q7K480|BN3D1_DROME Probable RNA methyltransferase bin3 OS=Drosophila melanogaster GN=bin3 PE=1 SV=1 Back     alignment and function description
>sp|A3KQ55|MEPCE_DANRE 7SK snRNA methylphosphate capping enzyme OS=Danio rerio GN=mepce PE=2 SV=2 Back     alignment and function description
>sp|Q7L2J0|MEPCE_HUMAN 7SK snRNA methylphosphate capping enzyme OS=Homo sapiens GN=MEPCE PE=1 SV=1 Back     alignment and function description
>sp|Q8K3A9|MEPCE_MOUSE 7SK snRNA methylphosphate capping enzyme OS=Mus musculus GN=Mepce PE=1 SV=2 Back     alignment and function description
>sp|Q9U2R0|BIN3D_CAEEL Probable RNA methyltransferase Y17G7B.18 OS=Caenorhabditis elegans GN=Y17G7B.18 PE=3 SV=1 Back     alignment and function description
>sp|Q6NPC9|BIN3D_ARATH Probable RNA methyltransferase At5g51130 OS=Arabidopsis thaliana GN=At5g51130 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y7L2|BIN3D_SCHPO Probable RNA methyltransferase C2A9.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2A9.10 PE=3 SV=1 Back     alignment and function description
>sp|Q9VZD2|BN3D3_DROME Probable RNA methyltransferase CG11342 OS=Drosophila melanogaster GN=CG11342 PE=3 SV=1 Back     alignment and function description
>sp|Q7T0L7|BN3D2_XENLA Pre-miRNA 5'-monophosphate methyltransferase OS=Xenopus laevis GN=bcdin3d PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query132
383860504 776 PREDICTED: 7SK snRNA methylphosphate cap 0.856 0.145 0.684 1e-42
350414874 639 PREDICTED: probable methyltransferase bi 0.939 0.194 0.64 3e-42
380016028 815 PREDICTED: uncharacterized protein LOC10 0.856 0.138 0.684 3e-42
332022338 724 7SK snRNA methylphosphate capping enzyme 0.946 0.172 0.608 3e-41
340722014 639 PREDICTED: probable methyltransferase bi 0.939 0.194 0.632 5e-41
307184813 681 7SK snRNA methylphosphate capping enzyme 0.863 0.167 0.669 1e-40
322778830 677 hypothetical protein SINV_08584 [Solenop 0.856 0.166 0.654 3e-40
307199471 1191 Flotillin-1 [Harpegnathos saltator] 0.848 0.094 0.654 5e-40
270013396 616 hypothetical protein TcasGA2_TC011992 [T 0.871 0.186 0.681 6e-40
189241018 621 PREDICTED: similar to conserved hypothet 0.871 0.185 0.681 6e-40
>gi|383860504|ref|XP_003705729.1| PREDICTED: 7SK snRNA methylphosphate capping enzyme-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 97/114 (85%), Gaps = 1/114 (0%)

Query: 2   EQAQFDVILCLSVTKWFHLNWGDSGIKRVFMRMYAQLREGGVLILEPQGFQSYKKKRKLT 61
           EQ QFD ILCLS+TKW HLN+GD+G+K+ F RMYAQLR GGVL+LEPQG+ SY KK+ LT
Sbjct: 446 EQPQFDTILCLSLTKWIHLNFGDAGLKQAFKRMYAQLRPGGVLVLEPQGWSSYTKKKNLT 505

Query: 62  DTIWRNFQAIEFFPHHFTEYLL-SEVGFTKCETLGSPLHPSKGFQRPIKMFTKG 114
           + I++N+++IEF PH+FT+YLL SEVGF+KCE L  P HPSKGFQRPI++FTK 
Sbjct: 506 ERIYKNYRSIEFRPHNFTQYLLSSEVGFSKCEVLSIPPHPSKGFQRPIQLFTKA 559

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350414874|ref|XP_003490452.1| PREDICTED: probable methyltransferase bin3-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380016028|ref|XP_003691995.1| PREDICTED: uncharacterized protein LOC100870180 [Apis florea] Back     alignment and taxonomy information
>gi|332022338|gb|EGI62650.1| 7SK snRNA methylphosphate capping enzyme [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340722014|ref|XP_003399407.1| PREDICTED: probable methyltransferase bin3-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307184813|gb|EFN71127.1| 7SK snRNA methylphosphate capping enzyme [Camponotus floridanus] Back     alignment and taxonomy information
>gi|322778830|gb|EFZ09246.1| hypothetical protein SINV_08584 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307199471|gb|EFN80084.1| Flotillin-1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|270013396|gb|EFA09844.1| hypothetical protein TcasGA2_TC011992 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189241018|ref|XP_969281.2| PREDICTED: similar to conserved hypothetical protein [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query132
FB|FBgn0037368300 CG1239 [Drosophila melanogaste 0.856 0.376 0.614 1.2e-33
FB|FBgn0263144 1367 bin3 "bicoid-interacting prote 0.833 0.080 0.612 3.7e-31
UNIPROTKB|F1RNM4670 LOC100513274 "Uncharacterized 0.863 0.170 0.513 4.3e-30
UNIPROTKB|F1RMY9690 LOC100513274 "Uncharacterized 0.863 0.165 0.513 4.7e-30
RGD|1560550329 Mepce "methylphosphate capping 0.848 0.340 0.495 1.3e-29
ZFIN|ZDB-GENE-030131-3936645 mepce "methylphosphate capping 0.848 0.173 0.526 1.3e-29
UNIPROTKB|Q7L2J0689 MEPCE "7SK snRNA methylphospha 0.825 0.158 0.527 2.1e-29
UNIPROTKB|A1L521220 BCDIN3 "Bin3, bicoid-interacti 0.848 0.509 0.495 2.7e-29
UNIPROTKB|E2RGJ1692 MEPCE "Uncharacterized protein 0.825 0.157 0.518 4.5e-29
MGI|MGI:106477666 Mepce "methylphosphate capping 0.848 0.168 0.504 5.2e-29
FB|FBgn0037368 CG1239 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 366 (133.9 bits), Expect = 1.2e-33, P = 1.2e-33
 Identities = 70/114 (61%), Positives = 88/114 (77%)

Query:     1 MEQAQFDVILCLSVTKWFHLNWGDSGIKRVFMRMYAQLREGGVLILEPQGFQSYKKKRKL 60
             +E+ QFDVILCLSVTKW HLN+ DSG+K+ F RMY QLR GG LILEPQ F  YK+++KL
Sbjct:   186 IERPQFDVILCLSVTKWIHLNFCDSGLKQAFRRMYLQLRPGGKLILEPQSFDGYKRRKKL 245

Query:    61 TDTIWRNFQAIEFFPHHFTEYLLS-EVGFTKCETLGSPLHPSKGFQRPIKMFTK 113
             ++ I  N+ AI+F P HFTEYLLS EVGF + + +G P H   GF+RPI++FTK
Sbjct:   246 SEQIRDNYNAIKFRPDHFTEYLLSPEVGFAEMKLMGIPEHCKVGFKRPIQIFTK 299
GO:0004652 "polynucleotide adenylyltransferase activity" evidence=ISS
GO:0005575 "cellular_component" evidence=ND
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0022008 "neurogenesis" evidence=IMP
FB|FBgn0263144 bin3 "bicoid-interacting protein 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1RNM4 LOC100513274 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1RMY9 LOC100513274 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1560550 Mepce "methylphosphate capping enzyme" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-3936 mepce "methylphosphate capping enzyme" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q7L2J0 MEPCE "7SK snRNA methylphosphate capping enzyme" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A1L521 BCDIN3 "Bin3, bicoid-interacting 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RGJ1 MEPCE "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:106477 Mepce "methylphosphate capping enzyme" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7L2J0MEPCE_HUMAN2, ., 1, ., 1, ., -0.50870.85600.1640yesN/A
Q9VNH1BN3D2_DROME2, ., 1, ., 1, ., -0.61400.85600.3766yesN/A
Q9U2R0BIN3D_CAEEL2, ., 1, ., 1, ., -0.53090.85600.2989yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
pfam06859110 pfam06859, Bin3, Bicoid-interacting protein 3 (Bin 3e-50
>gnl|CDD|148462 pfam06859, Bin3, Bicoid-interacting protein 3 (Bin3) Back     alignment and domain information 
 Score =  155 bits (393), Expect = 3e-50
 Identities = 67/110 (60%), Positives = 86/110 (78%), Gaps = 1/110 (0%)

Query: 5   QFDVILCLSVTKWFHLNWGDSGIKRVFMRMYAQLREGGVLILEPQGFQSYKKKRKLTDTI 64
           +FDVILCLSVTKW HLNWGD G+KR F R+Y  LR GG+LILEPQ + SYKK++KL++TI
Sbjct: 1   EFDVILCLSVTKWVHLNWGDEGLKRFFRRIYRLLRPGGILILEPQPWDSYKKRKKLSETI 60

Query: 65  WRNFQAIEFFPHHFTEYLLS-EVGFTKCETLGSPLHPSKGFQRPIKMFTK 113
           ++N++ I+  P  F EYLLS EVGF+  E +G P + SKGF+RPI +F K
Sbjct: 61  YKNYERIKLKPDQFEEYLLSPEVGFSSYELVGVPNNTSKGFKRPIYIFHK 110

This family represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3). Bin3, which shows similarity to a number of protein methyltransferases that modify RNA-binding proteins, interacts with Bicoid, which itself directs pattern formation in the early Drosophila embryo. The interaction might allow Bicoid to switch between its dual roles in transcription and translation. Note that family members contain a conserved HLN motif. Length = 110

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 132
PF06859110 Bin3: Bicoid-interacting protein 3 (Bin3); InterPr 100.0
KOG2899|consensus288 100.0
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 98.01
TIGR00452314 methyltransferase, putative. Known examples to dat 97.8
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 97.78
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 97.62
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 97.55
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 97.37
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 96.96
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 96.88
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 96.86
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 96.84
PRK08317241 hypothetical protein; Provisional 96.72
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 96.59
PRK11207197 tellurite resistance protein TehB; Provisional 96.53
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 96.5
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 96.4
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 96.38
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 96.36
PLN02244340 tocopherol O-methyltransferase 96.36
TIGR00536284 hemK_fam HemK family putative methylases. The gene 96.33
PRK10611287 chemotaxis methyltransferase CheR; Provisional 96.3
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 96.29
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 96.25
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 96.22
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 96.11
PLN02232160 ubiquinone biosynthesis methyltransferase 96.1
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 95.95
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 95.93
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 95.88
PRK00811283 spermidine synthase; Provisional 95.84
PLN02490340 MPBQ/MSBQ methyltransferase 95.82
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 95.81
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 95.73
PRK12335287 tellurite resistance protein TehB; Provisional 95.65
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 95.64
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 95.62
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 95.53
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 95.51
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 95.5
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 95.5
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 95.46
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 95.35
PLN02233261 ubiquinone biosynthesis methyltransferase 95.21
PLN02336475 phosphoethanolamine N-methyltransferase 94.99
PLN02585315 magnesium protoporphyrin IX methyltransferase 94.92
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 94.84
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 94.77
PRK10258251 biotin biosynthesis protein BioC; Provisional 94.75
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 94.72
PLN02336 475 phosphoethanolamine N-methyltransferase 94.72
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 94.6
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 94.57
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 94.55
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 94.53
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 94.5
TIGR00740239 methyltransferase, putative. A simple BLAST search 94.46
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 94.44
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 94.25
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 94.15
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 94.02
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 93.86
PLN02366308 spermidine synthase 93.83
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 93.72
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 93.67
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 93.5
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 93.42
PRK06922677 hypothetical protein; Provisional 93.22
KOG3178|consensus342 93.14
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 93.13
PLN03075296 nicotianamine synthase; Provisional 93.08
TIGR00438188 rrmJ cell division protein FtsJ. 92.96
COG4798238 Predicted methyltransferase [General function pred 92.61
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 92.56
PRK04266226 fibrillarin; Provisional 92.52
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 92.51
PRK00536262 speE spermidine synthase; Provisional 92.35
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 92.34
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 92.29
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 92.23
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 92.17
PRK14967223 putative methyltransferase; Provisional 92.1
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 92.0
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 91.99
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 91.97
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 91.64
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 91.62
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 91.28
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 90.98
TIGR03438301 probable methyltransferase. This model represents 90.64
PRK14968188 putative methyltransferase; Provisional 90.32
PRK04457262 spermidine synthase; Provisional 90.23
PTZ00146293 fibrillarin; Provisional 89.97
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 89.34
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 88.86
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 88.77
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 88.2
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 87.82
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 87.81
PRK01581374 speE spermidine synthase; Validated 87.69
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 87.53
KOG4300|consensus252 87.31
PRK07402196 precorrin-6B methylase; Provisional 87.26
PRK03612521 spermidine synthase; Provisional 87.09
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 87.03
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 86.87
PRK13255218 thiopurine S-methyltransferase; Reviewed 86.8
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 86.72
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 86.49
PLN02823336 spermine synthase 86.3
KOG1270|consensus282 86.24
PRK06202232 hypothetical protein; Provisional 85.89
COG0421282 SpeE Spermidine synthase [Amino acid transport and 85.88
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 84.71
PRK10901427 16S rRNA methyltransferase B; Provisional 83.41
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 83.12
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 81.78
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 80.49
PRK14904445 16S rRNA methyltransferase B; Provisional 80.36
PRK14902444 16S rRNA methyltransferase B; Provisional 80.34
>PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) Back     alignment and domain information 
Probab=100.00  E-value=4.5e-59  Score=342.99  Aligned_cols=109  Identities=59%  Similarity=1.123  Sum_probs=81.3

Q ss_pred             ceeEEEEeeeeeeeeccCCcHHHHHHHHHHHHhhcCCcEEEEecccchhhHhhhcCChhhhccccceEEcccchHHHHHh
Q psy5241           5 QFDVILCLSVTKWFHLNWGDSGIKRVFMRMYAQLREGGVLILEPQGFQSYKKKRKLTDTIWRNFQAIEFFPHHFTEYLLS   84 (132)
Q Consensus         5 ~fDvIlclSVTKWIHLN~GD~GL~~ff~r~~~~L~pGg~liLEpQpWksY~r~~kl~~~~~~~~~~L~lrP~~f~~yLl~   84 (132)
                      +|||||||||||||||||||+||++||++|+++|+|||+||||||||+||++++++++++++||++|++||++|++||++
T Consensus         1 ~yDvilclSVtkWIHLn~GD~Gl~~~f~~~~~~L~pGG~lilEpQ~w~sY~~~~~~~~~~~~n~~~i~lrP~~F~~~L~~   80 (110)
T PF06859_consen    1 QYDVILCLSVTKWIHLNWGDEGLKRFFRRIYSLLRPGGILILEPQPWKSYKKAKRLSEEIRENYKSIKLRPDQFEDYLLE   80 (110)
T ss_dssp             -EEEEEEES-HHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEE---HHHHHTTTTS-HHHHHHHHH----GGGHHHHHTS
T ss_pred             CccEEEEEEeeEEEEecCcCHHHHHHHHHHHHhhCCCCEEEEeCCCcHHHHHHhhhhHHHHhHHhceEEChHHHHHHHHh
Confidence            69999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             -ccCCeeEEEcCCCCCCCCCCCcceEEEEc
Q psy5241          85 -EVGFTKCETLGSPLHPSKGFQRPIKMFTK  113 (132)
Q Consensus        85 -~vGF~~~~~l~~~~~~~~gf~RpI~lf~K  113 (132)
                       +|||++++.++.+.++++||+|||++|+|
T Consensus        81 ~evGF~~~e~~~~~~~~~~gF~RpI~lf~K  110 (110)
T PF06859_consen   81 PEVGFSSVEELGVPENSSKGFDRPIYLFRK  110 (110)
T ss_dssp             TTT---EEEEE-------------EEEEE-
T ss_pred             cccceEEEEEcccCCCCCCCCCCcEEEEeC
Confidence             79999999999988788999999999997

Bin3, which shows similarity to a number of protein methyltransferases that modify RNA-binding proteins, interacts with Bicoid, which itself directs pattern formation in the early Drosophila embryo. The interaction might allow Bicoid to switch between its dual roles in transcription and translation []. Note that proteins of the entry contain a conserved HLN motif.; GO: 0008168 methyltransferase activity; PDB: 3G07_B.
>KOG2899|consensus Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>KOG3178|consensus Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>KOG4300|consensus Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>KOG1270|consensus Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
3g07_A292 Methyltransferase Domain Of Human Bicoid-Interactin 1e-31
>pdb|3G07|A Chain A, Methyltransferase Domain Of Human Bicoid-Interacting Protein 3 Homolog (Drosophila) Length = 292 Back     alignment and structure 
Iteration: 1

 Score =  131 bits (329), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 58/114 (50%), Positives = 83/114 (72%), Gaps = 1/114 (0%)
Query: 2   EQAQFDVILCLSVTKWFHLNWGDSGIKRVFMRMYAQLREGGVLILEPQGFQSYKKKRKLT 61
           +  ++DV+LCLS+TKW HLNWGD G+KR F R+Y  LR GG+L+LEPQ + SY K++ LT
Sbjct: 174 QTPEYDVVLCLSLTKWVHLNWGDEGLKRXFRRIYRHLRPGGILVLEPQPWSSYGKRKTLT 233
Query: 62  DTIWRNFQAIEFFPHHFTEYLLS-EVGFTKCETLGSPLHPSKGFQRPIKMFTKG 114
           +TI++N+  I+  P  F+ YL S +VGF+  E + +P + SKGFQRP+ +F K 
Sbjct: 234 ETIYKNYYRIQLKPEQFSSYLTSPDVGFSSYELVATPHNTSKGFQRPVYLFHKA 287

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 5e-44
1wzn_A252 SAM-dependent methyltransferase; structural genomi 3e-04
3dtn_A234 Putative methyltransferase MM_2633; structural gen 4e-04
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 5e-04
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Length = 292 Back     alignment and structure
 Score =  144 bits (364), Expect = 5e-44
 Identities = 58/116 (50%), Positives = 84/116 (72%), Gaps = 1/116 (0%)

Query: 1   MEQAQFDVILCLSVTKWFHLNWGDSGIKRVFMRMYAQLREGGVLILEPQGFQSYKKKRKL 60
            +  ++DV+LCLS+TKW HLNWGD G+KR+F R+Y  LR GG+L+LEPQ + SY K++ L
Sbjct: 173 AQTPEYDVVLCLSLTKWVHLNWGDEGLKRMFRRIYRHLRPGGILVLEPQPWSSYGKRKTL 232

Query: 61  TDTIWRNFQAIEFFPHHFTEYLLS-EVGFTKCETLGSPLHPSKGFQRPIKMFTKGS 115
           T+TI++N+  I+  P  F+ YL S +VGF+  E + +P + SKGFQRP+ +F K  
Sbjct: 233 TETIYKNYYRIQLKPEQFSSYLTSPDVGFSSYELVATPHNTSKGFQRPVYLFHKAR 288
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 252 Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Length = 234 Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Length = 239 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query132
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 99.98
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 98.31
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 98.22
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 98.07
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.0
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 97.98
3i9f_A170 Putative type 11 methyltransferase; structural gen 97.96
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 97.96
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 97.92
3dtn_A234 Putative methyltransferase MM_2633; structural gen 97.91
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 97.91
2i62_A265 Nicotinamide N-methyltransferase; structural genom 97.89
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 97.88
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 97.84
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 97.76
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 97.76
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 97.73
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 97.72
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 97.7
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 97.69
3hnr_A220 Probable methyltransferase BT9727_4108; structural 97.69
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 97.67
2p7i_A250 Hypothetical protein; putative methyltransferase, 97.65
1wzn_A252 SAM-dependent methyltransferase; structural genomi 97.64
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 97.64
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 97.61
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 97.6
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 97.57
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 97.57
1vlm_A219 SAM-dependent methyltransferase; possible histamin 97.56
3dp7_A363 SAM-dependent methyltransferase; structural genomi 97.56
3f4k_A257 Putative methyltransferase; structural genomics, P 97.53
3lcc_A235 Putative methyl chloride transferase; halide methy 97.52
3dh0_A219 SAM dependent methyltransferase; cystal structure, 97.52
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 97.5
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 97.5
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 97.47
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 97.46
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 97.43
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 97.39
1vl5_A260 Unknown conserved protein BH2331; putative methylt 97.39
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 97.35
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 97.33
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 97.33
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 97.32
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 97.32
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 97.32
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 97.3
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 97.3
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 97.28
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 97.27
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 97.25
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 97.25
3cc8_A230 Putative methyltransferase; structural genomics, j 97.24
1xxl_A239 YCGJ protein; structural genomics, protein structu 97.24
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 97.23
3ocj_A305 Putative exported protein; structural genomics, PS 97.22
2kw5_A202 SLR1183 protein; structural genomics, northeast st 97.22
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 97.21
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 97.17
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 97.16
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 97.13
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 97.11
3ege_A261 Putative methyltransferase from antibiotic biosyn 97.08
2i7c_A283 Spermidine synthase; transferase, structural genom 97.08
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 97.08
3lpm_A259 Putative methyltransferase; structural genomics, p 97.06
2r3s_A335 Uncharacterized protein; methyltransferase domain, 97.05
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 97.04
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 97.03
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 97.02
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 96.99
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 96.96
3gu3_A284 Methyltransferase; alpha-beta protein, structural 96.91
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 96.88
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 96.87
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 96.81
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 96.78
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 96.77
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 96.76
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 96.76
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 96.75
2o07_A304 Spermidine synthase; structural genomics, structur 96.71
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 96.7
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 96.69
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 96.66
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 96.65
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 96.65
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 96.63
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 96.6
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 96.58
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 96.57
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 96.56
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 96.56
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 96.56
2pt6_A321 Spermidine synthase; transferase, structural genom 96.52
1xj5_A334 Spermidine synthase 1; structural genomics, protei 96.52
4hg2_A257 Methyltransferase type 11; structural genomics, PS 96.47
3m70_A286 Tellurite resistance protein TEHB homolog; structu 96.46
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 96.45
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 96.43
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 96.43
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 96.43
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 96.41
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 96.32
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 96.32
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 96.32
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 96.3
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 96.29
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 96.25
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 96.24
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 96.09
1jsx_A207 Glucose-inhibited division protein B; methyltransf 96.07
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 96.06
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 96.04
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 96.01
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 95.95
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 95.88
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 95.86
2b3t_A276 Protein methyltransferase HEMK; translation termin 95.8
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 95.79
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 95.71
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 95.62
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 95.55
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 95.53
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 95.5
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 95.5
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 95.44
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 95.31
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 95.29
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 95.28
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 95.28
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 95.28
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 95.26
3duw_A223 OMT, O-methyltransferase, putative; alternating of 95.26
3sso_A419 Methyltransferase; macrolide, natural product, ros 95.26
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 95.25
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 95.19
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 95.17
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 95.13
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 95.08
2avd_A229 Catechol-O-methyltransferase; structural genomics, 95.01
3m33_A226 Uncharacterized protein; structural genomics, PSI- 94.98
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 94.91
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 94.76
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 94.69
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 94.67
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 94.61
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 94.61
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 94.58
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 94.37
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 94.34
2cmg_A262 Spermidine synthase; transferase, putrescine amino 94.32
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 94.31
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 94.3
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 94.29
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 94.27
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 94.25
3b5i_A374 S-adenosyl-L-methionine:salicylic acid carboxyl me 94.21
3gjy_A317 Spermidine synthase; APC62791, structural genomics 94.11
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 94.05
1ws6_A171 Methyltransferase; structural genomics, riken stru 94.0
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 93.93
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 93.91
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 93.9
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 93.88
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 93.8
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 93.79
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 93.78
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 93.72
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 93.61
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 93.58
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 93.47
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 93.46
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 93.17
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 93.14
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 93.1
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 92.95
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 92.7
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 92.63
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 92.59
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 92.56
2qm3_A373 Predicted methyltransferase; putative methyltransf 92.46
3khk_A544 Type I restriction-modification system methylation 92.37
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 92.36
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 92.19
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 92.14
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 92.1
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 92.09
3giw_A277 Protein of unknown function DUF574; rossmann-fold 91.89
2fyt_A340 Protein arginine N-methyltransferase 3; structural 91.85
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 91.78
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 91.72
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 91.66
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 91.6
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 91.59
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 91.54
1yb2_A275 Hypothetical protein TA0852; structural genomics, 91.5
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 91.38
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 91.36
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 91.29
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 91.26
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 91.17
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 91.13
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 91.01
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 90.89
2esr_A177 Methyltransferase; structural genomics, hypothetic 90.86
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 90.59
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 90.56
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 90.11
2b78_A385 Hypothetical protein SMU.776; structure genomics, 90.11
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 89.81
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 89.7
2frn_A278 Hypothetical protein PH0793; structural genomics, 89.47
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 89.46
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 89.43
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 89.37
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 89.32
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 88.87
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 88.8
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 88.72
2fpo_A202 Methylase YHHF; structural genomics, putative meth 88.58
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 88.43
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 88.1
2b25_A336 Hypothetical protein; structural genomics, methyl 87.69
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 87.69
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 87.68
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 87.14
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 85.04
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 84.93
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 84.82
1m6e_X359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 83.57
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 83.44
3cvo_A202 Methyltransferase-like protein of unknown functio; 83.19
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 82.78
2efj_A384 3,7-dimethylxanthine methyltransferase; SAM-depend 82.5
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 81.86
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 81.0
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
Probab=99.98  E-value=1.4e-33  Score=224.05  Aligned_cols=115  Identities=50%  Similarity=1.037  Sum_probs=99.4

Q ss_pred             CCcceeEEEEeeeeeeeeccCCcHHHHHHHHHHHHhhcCCcEEEEecccchhhHhhhcCChhhhccccceEEcccchHHH
Q psy5241           2 EQAQFDVILCLSVTKWFHLNWGDSGIKRVFMRMYAQLREGGVLILEPQGFQSYKKKRKLTDTIWRNFQAIEFFPHHFTEY   81 (132)
Q Consensus         2 ~~~~fDvIlclSVTKWIHLN~GD~GL~~ff~r~~~~L~pGg~liLEpQpWksY~r~~kl~~~~~~~~~~L~lrP~~f~~y   81 (132)
                      ..+.||+|+|++|++||||||+|+++.++|++++++|+|||+||||+|+|++|+++++++++++++|.+|+++|++|.++
T Consensus       174 ~~~~fD~I~~~~vl~~ihl~~~~~~~~~~l~~~~~~LkpGG~lil~~~~~~~y~~~~~~~~~~~~~~~~~~~~p~~~~~~  253 (292)
T 3g07_A          174 QTPEYDVVLCLSLTKWVHLNWGDEGLKRMFRRIYRHLRPGGILVLEPQPWSSYGKRKTLTETIYKNYYRIQLKPEQFSSY  253 (292)
T ss_dssp             CCCCEEEEEEESCHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEECCCHHHHHTTTTSCHHHHHHHHHCCCCGGGHHHH
T ss_pred             cCCCcCEEEEChHHHHhhhcCCHHHHHHHHHHHHHHhCCCcEEEEecCCchhhhhhhcccHHHHhhhhcEEEcHHHHHHH
Confidence            35789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHh-ccCCeeEEEcCCCCCCCCCCCcceEEEEcCCC
Q psy5241          82 LLS-EVGFTKCETLGSPLHPSKGFQRPIKMFTKGSK  116 (132)
Q Consensus        82 Ll~-~vGF~~~~~l~~~~~~~~gf~RpI~lf~K~~~  116 (132)
                      |++ ++||+.++.++.+....+||+|+|++|+|++.
T Consensus       254 L~~~~~GF~~~~~~~~~~~~~~g~~r~i~~~~k~~~  289 (292)
T 3g07_A          254 LTSPDVGFSSYELVATPHNTSKGFQRPVYLFHKARS  289 (292)
T ss_dssp             HTSTTTCCCEEEEC-----------CCCEEEECCC-
T ss_pred             HHhcCCCceEEEEeccCCCCCCCccceEEEEEcCCC
Confidence            987 79999999999876678999999999999854
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 132
d2g72a1263 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltr 9e-05
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Arylamine N-methyltransferase
domain: Phenylethanolamine N-methyltransferase, PNMTase
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 38.3 bits (88), Expect = 9e-05
 Identities = 17/116 (14%), Positives = 28/116 (24%), Gaps = 19/116 (16%)

Query: 2   EQAQFDVILCLSVTKWFHLNWGDSGIKRVFMRMYAQLREGGVLILEPQGFQSYKKKRKLT 61
                D ++     +    +      +R    +   LR GG L+L               
Sbjct: 154 APLPADALVSAFCLEAVSPDLAS--FQRALDHITTLLRPGGHLLLIG-----------AL 200

Query: 62  DTIWRNFQAIEFFPHHFTE----YLLSEVGFT--KCETLGSPLHPSKGFQRPIKMF 111
           +  W             +E      L   G+      T   P H   G      +F
Sbjct: 201 EESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVF 256

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query132
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 98.3
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 98.01
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 97.92
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 97.89
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 97.86
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 97.78
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 97.74
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 97.71
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 97.57
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 97.56
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 97.53
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 97.53
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 97.27
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 97.24
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 97.21
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 97.13
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 97.13
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 97.12
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 97.02
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 96.96
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 96.94
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 96.89
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 96.86
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 96.71
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 96.55
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 96.45
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 95.93
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 95.82
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 95.35
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 94.68
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 94.56
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 94.1
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 93.96
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 93.57
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 93.4
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 93.3
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 92.97
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 92.65
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 91.21
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 90.56
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 90.54
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 90.36
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 89.29
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 89.04
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 88.65
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 88.57
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 88.22
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 88.13
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 88.02
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 88.02
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 86.29
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 84.6
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 83.96
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 82.0
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 81.47
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 80.9
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Arylamine N-methyltransferase
domain: Phenylethanolamine N-methyltransferase, PNMTase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.30  E-value=6.3e-08  Score=74.06  Aligned_cols=80  Identities=15%  Similarity=0.165  Sum_probs=59.1

Q ss_pred             cceeEEEEeeeeeeeeccCCcHHHHHHHHHHHHhhcCCcEEEEecccchhhHhhhcCChhhhccccceEEcccchHHHHH
Q psy5241           4 AQFDVILCLSVTKWFHLNWGDSGIKRVFMRMYAQLREGGVLILEPQGFQSYKKKRKLTDTIWRNFQAIEFFPHHFTEYLL   83 (132)
Q Consensus         4 ~~fDvIlclSVTKWIHLN~GD~GL~~ff~r~~~~L~pGg~liLEpQpWksY~r~~kl~~~~~~~~~~L~lrP~~f~~yLl   83 (132)
                      ..||+|+|..|.-|||-|..|  +++++++++++|||||+||+--..-..|...   +   ...|..+.+.++++.+.|.
T Consensus       156 ~~fD~V~~~~~l~~i~~~~~~--~~~~l~~~~~~LkPGG~li~~~~~~~~~~~~---~---~~~~~~~~~t~e~v~~~l~  227 (263)
T d2g72a1         156 LPADALVSAFCLEAVSPDLAS--FQRALDHITTLLRPGGHLLLIGALEESWYLA---G---EARLTVVPVSEEEVREALV  227 (263)
T ss_dssp             SSEEEEEEESCHHHHCSSHHH--HHHHHHHHHTTEEEEEEEEEEEEESCCEEEE---T---TEEEECCCCCHHHHHHHHH
T ss_pred             CccCeeeeHHHHHHHccCHHH--HHHHHHHHHHHcCCCCEEEEecccCCccccc---C---CcccccCCCCHHHHHHHHH
Confidence            479999999999999988644  9999999999999999999976543332211   0   1223445566788888665


Q ss_pred             hccCCeeEE
Q psy5241          84 SEVGFTKCE   92 (132)
Q Consensus        84 ~~vGF~~~~   92 (132)
                       +.||+.++
T Consensus       228 -~aGf~v~~  235 (263)
T d2g72a1         228 -RSGYKVRD  235 (263)
T ss_dssp             -HTTEEEEE
T ss_pred             -HCCCeEEE
Confidence             57998654
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure