Diaphorina citri psyllid: psy5244


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90
MDIVKSLQKACQGELQQSVRLSSCGPSTKDTKTKADQTDSTLRLWVKKYGWKELDNGYIFIANQDENIKTKNITEKIEFENAATIMTSNV
cHHHHHHHHHHccHHHHHHHHcccccccHHHHHcccccHHHHHHHHHHHccCCccccEEEEECccccccccccEEEEcccHHHHHHHHcc
****KS*QKACQGELQQSVRLSSCGPSTKDTKTKADQTDSTLRLWVKKYGWKELDNGYIFIANQDENIKTKNITEKIEFENAATIMTSN*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDIVKSLQKACQGELQQSVRLSSCGPSTKDTKTKADQTDSTLRLWVKKYGWKELDNGYIFIANQDENIKTKNITEKIEFENAATIMTSNV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Eukaryotic translation initiation factor 3 subunit K Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome.confidentQ28C65
Eukaryotic translation initiation factor 3 subunit K Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome.confidentQ9W2D9
Eukaryotic translation initiation factor 3 subunit K Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome.confidentQ7QGK4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1RZ4, chain A
Confidence level:very confident
Coverage over the Query: 4-85
View the alignment between query and template
View the model in PyMOL