Diaphorina citri psyllid: psy5259


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290----
MSKPKLLLTRNDYPRVSPAYDILEDMFDIITYPISEGRMPRDIFIEKLKGCSALLCNPHQKVDKEALDESGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVKNLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGEWALKQTQTVISDIIGLNGSTVGIVGTELGAQLVPLDTLCAQSDFIFVTCALTKDTEQLIGRKQFRGGLLDQEALVEFLRDKKIGGAGLDVMIPEPMPADHPLVQLDNC
ccccEEEEEccccccccHHHHHHHccccEEECccccccccHHHHHHHcccccEEEEcccccccHHHHHHcccccEEEEEcccccccccHHHHHHcccEEccccccccHHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHcccEEECcccccHHHHHHHHHHHHHHHHHccHHHHHHHHcccccccccccccEEEEEEccccccHHHHHcccEEEcHHHHHHHccEEEEEccccHHHHccccccccccccccHHHHHHHHHcccEEEEcccccccccccccccccccccc
*SKPKLLLTRNDYPRVSPAYDILEDMFDIITYPISEGRMPRDIFIEKLKGCSALLCNPHQKVDKEALDESGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVKNLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGEWALKQTQTVISDIIGLNGSTVGIVGTELGAQLVPLDTLCAQSDFIFVTCALTKDTEQLIGRKQFRGGLLDQEALVEFLRDKKIGGAGLDVMIPEPMPADHPLVQLDNC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKPKLLLTRNDYPRVSPAYDILEDMFDIITYPISEGRMPRDIFIEKLKGCSALLCNPHQKVDKEALDESGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVKNLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGEWALKQTQTVISDIIGLNGSTVGIVGTELGAQLVPLDTLCAQSDFIFVTCALTKDTEQLIGRKQFRGGLLDQEALVEFLRDKKIGGAGLDVMIPEPMPADHPLVQLDNC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glyoxylate reductase/hydroxypyruvate reductase Enzyme with hydroxy-pyruvate reductase, glyoxylate reductase and D-glycerate dehydrogenase enzymatic activities. Reduces hydroxypyruvate to D-glycerate, glyoxylate to glycolate oxidizes D-glycerate to hydroxypyruvate.confidentQ9UBQ7
Glyoxylate reductase/hydroxypyruvate reductase Enzyme with hydroxy-pyruvate reductase, glyoxylate reductase and D-glycerate dehydrogenase enzymatic activities. Reduces hydroxypyruvate to D-glycerate, glyoxylate to glycolate oxidizes D-glycerate to hydroxypyruvate.confidentQ91Z53

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0016618 [MF]hydroxypyruvate reductase activityprobableGO:0003824, GO:0003674, GO:0016614, GO:0016616, GO:0016491
GO:0030267 [MF]glyoxylate reductase (NADP) activityprobableGO:0003824, GO:0003674, GO:0016614, GO:0016616, GO:0016491

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GCG, chain A
Confidence level:very confident
Coverage over the Query: 2-102,153-294
View the alignment between query and template
View the model in PyMOL
Template: 2J6I, chain A
Confidence level:confident
Coverage over the Query: 134-172
View the alignment between query and template
View the model in PyMOL
Template: 3RE1, chain A
Confidence level:confident
Coverage over the Query: 2-156
View the alignment between query and template
View the model in PyMOL