Diaphorina citri psyllid: psy5260

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140--
MVCLLVCSTPLQVWAPWLSHFYYLDYDVYIIPHSNGAVTLGGCRHYDSYSRDISRHDTASILERCYSLLPRLEEAPVLYEWCGLRPHRSLVRVEIEQIGRLKVIHNYGHGGYGVTTAPGTSRYAVQLVKQALDPTSSLKSKL
cCEEECcccEEEEEcccEEEEEECccCEEEECccccEEEEEEEECcccccccccHHHHHHHHHHHHHHccccccccEEEEECcccccccccEEEEEEEccEEEEEECccccccccccHHHHHHHHHHHHHHccccccccccc
MVCLLVCSTPLQVWAPWLSHFYYLDYDVYIIPHSNGAVTLGGCRHYDSYSRDISRHDTASILERCYSLLPRLEEAPVLYEWCGLRPHRSLVRVEIEQIGRLKVIHNYGHGGYGVTTAPGTSRYAVQLVKQA***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVCLLVCSTPLQVWAPWLSHFYYLDYDVYIIPHSNGAVTLGGCRHYDSYSRDISRHDTASILERCYSLLPRLEEAPVLYEWCGLRPHRSLVRVEIEQIGRLKVIHNYGHGGYGVTTAPGTSRYAVQLVKQALDPTSSLKSKL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable D-amino-acid oxidase confidentO07727

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044710 [BP]single-organism metabolic processprobableGO:0008150, GO:0008152
GO:0048037 [MF]cofactor bindingprobableGO:0003674, GO:0005488
GO:0047821 [MF]D-glutamate oxidase activityprobableGO:0003824, GO:0016641, GO:0003674, GO:0016638, GO:0016491
GO:0008445 [MF]D-aspartate oxidase activityprobableGO:0015922, GO:0016638, GO:0016641, GO:0003824, GO:0003674, GO:0016491

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3G3E, chain A
Confidence level:very confident
Coverage over the Query: 3-134
View the alignment between query and template
View the model in PyMOL