Diaphorina citri psyllid: psy5266


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180
TATDYYQRDLTGTPGQVHLIVCVLIRYHVDLTGGSKQVYLILVIRTRSAQSDFIFVTCALTKDTEQLIGRKQFSLMKPTAILINTSRGGLLDQEALVEFLRDKKIGGAGLDVMIPEPLPADHPLVQLDNCGNGLLDQEALVEFLRDKKIGGAGLDVMIPEPMPADHPLVQLDNCEIRGGT
cccccHHHcccccccEEEEEEEccccccccccccccccHHHHHHHHHHccccEEEEEccccHHHHccccHHHHHccccccEEEEccccccccHHHHHHHHHccccEEEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccc
***DYYQRDLTGTPGQVHLIVCVLIRYHVDLTGGSKQVYLILVIRTRSAQSDFIFVTCALTKDTEQLIGRKQFSLMKPTAILINTSRGGLLDQEALVEFLRDKKIGGAGLDVMIPEPLPADHPLVQLDNCGNGLLDQEALVEFLRDKKIGGAGLDVMIPEPMPADHPLVQLDNCEI*G**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TATDYYQRDLTGTPGQVHLIVCVLIRYHVDLTGGSKQVYLILVIRTRSAQSDFIFVTCALTKDTEQLIGRKQFSLMKPTAILINTSRGGLLDQEALVEFLRDKKIGGAGLDVMIPEPLPADHPLVQLDNCGNGLLDQEALVEFLRDKKIGGAGLDVMIPEPMPADHPLVQLDNCEIRGGT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glyoxylate reductase/hydroxypyruvate reductase Enzyme with hydroxy-pyruvate reductase, glyoxylate reductase and D-glycerate dehydrogenase enzymatic activities. Reduces hydroxypyruvate to D-glycerate, glyoxylate to glycolate oxidizes D-glycerate to hydroxypyruvate.confidentQ9UBQ7
Glyoxylate/hydroxypyruvate reductase B Catalyzes the NADPH-dependent reduction of glyoxylate and hydroxypyruvate into glycolate and glycerate, respectively.confidentQ6DB24
Glyoxylate reductase/hydroxypyruvate reductase Enzyme with hydroxy-pyruvate reductase, glyoxylate reductase and D-glycerate dehydrogenase enzymatic activities. Reduces hydroxypyruvate to D-glycerate, glyoxylate to glycolate oxidizes D-glycerate to hydroxypyruvate.confidentQ91Z53

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008465 [MF]glycerate dehydrogenase activityprobableGO:0003824, GO:0003674, GO:0016614, GO:0016616, GO:0016491
GO:0016020 [CC]membraneprobableGO:0005575
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006807 [BP]nitrogen compound metabolic processprobableGO:0008150, GO:0008152
GO:0070402 [MF]NADPH bindingprobableGO:0043168, GO:0050662, GO:0050661, GO:0097159, GO:0000166, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:0043167, GO:1901363, GO:1901265
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0031406 [MF]carboxylic acid bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0043167
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0051259 [BP]protein oligomerizationprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0007588 [BP]excretionprobableGO:0032501, GO:0008150, GO:0044699, GO:0044707, GO:0003008
GO:0051287 [MF]NAD bindingprobableGO:0050662, GO:0097159, GO:0000166, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:1901363, GO:1901265
GO:0031981 [CC]nuclear lumenprobableGO:0005575, GO:0043231, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0043648 [BP]dicarboxylic acid metabolic processprobableGO:0044710, GO:0006082, GO:0044237, GO:0009987, GO:0019752, GO:0071704, GO:0008150, GO:0044281, GO:0008152, GO:0043436
GO:0016618 [MF]hydroxypyruvate reductase activityprobableGO:0003824, GO:0003674, GO:0016614, GO:0016616, GO:0016491
GO:0005576 [CC]extracellular regionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EVT, chain A
Confidence level:very confident
Coverage over the Query: 11-133
View the alignment between query and template
View the model in PyMOL
Template: 3EVT, chain A
Confidence level:very confident
Coverage over the Query: 57-178
View the alignment between query and template
View the model in PyMOL