Psyllid ID: psy5266
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 180 | ||||||
| 67043779 | 325 | putative glyoxylate reductase/hydroxypyr | 0.661 | 0.366 | 0.456 | 4e-21 | |
| 320166407 | 342 | glyoxylate reductase/hydroxypyruvate red | 0.45 | 0.236 | 0.555 | 2e-20 | |
| 421056881 | 343 | D-isomer specific 2-hydroxyacid dehydrog | 0.45 | 0.236 | 0.580 | 4e-20 | |
| 392963323 | 343 | D-isomer specific 2-hydroxyacid dehydrog | 0.45 | 0.236 | 0.580 | 4e-20 | |
| 363745151 | 199 | PREDICTED: probable 2-ketogluconate redu | 0.45 | 0.407 | 0.580 | 5e-20 | |
| 193659821 | 330 | PREDICTED: glyoxylate reductase/hydroxyp | 0.555 | 0.303 | 0.471 | 5e-20 | |
| 427784185 | 360 | Putative d-3-phosphoglycerate dehydrogen | 0.45 | 0.225 | 0.592 | 6e-20 | |
| 260837447 | 326 | hypothetical protein BRAFLDRAFT_104160 [ | 0.455 | 0.251 | 0.560 | 7e-20 | |
| 195117570 | 401 | GI23165 [Drosophila mojavensis] gi|19391 | 0.683 | 0.306 | 0.432 | 8e-20 | |
| 239789714 | 182 | ACYPI003712 [Acyrthosiphon pisum] | 0.444 | 0.439 | 0.587 | 1e-19 |
| >gi|67043779|gb|AAY63988.1| putative glyoxylate reductase/hydroxypyruvate reductase [Lysiphlebus testaceipes] | Back alignment and taxonomy information |
|---|
Score = 106 bits (264), Expect = 4e-21, Method: Compositional matrix adjust.
Identities = 58/127 (45%), Positives = 80/127 (62%), Gaps = 8/127 (6%)
Query: 44 IRTRSAQSDFIFVTCALTKDTEQLIGRKQFSLMKPTAILINTSRGGLLDQEALVEFLRDK 103
+ T +SDFI VT ALT +T ++ G+ F +MK TAI IN SRG ++DQ AL++ L++
Sbjct: 197 LNTLLTESDFIIVTIALTPETREMFGKSSFDMMKSTAIFINISRGEIVDQPALIDALKNN 256
Query: 104 KIGGAGLDVMIPEPLPADHPLVQLDNC------GNGLLDQEALVEFLRDKKIGGAGLDVM 157
KI GAGLDVM PEP+P DH L++LDNC G+ ++ + + K I A LD
Sbjct: 257 KIRGAGLDVMTPEPIPLDHELLKLDNCVLLPHIGSAAIEARREMSVITAKNI-SAVLDGH 315
Query: 158 IPEPMPA 164
PE MP+
Sbjct: 316 -PENMPS 321
|
Source: Lysiphlebus testaceipes Species: Lysiphlebus testaceipes Genus: Lysiphlebus Family: Braconidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|320166407|gb|EFW43306.1| glyoxylate reductase/hydroxypyruvate reductase [Capsaspora owczarzaki ATCC 30864] | Back alignment and taxonomy information |
|---|
| >gi|421056881|ref|ZP_15519798.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein [Pelosinus fermentans B4] gi|421060503|ref|ZP_15522972.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein [Pelosinus fermentans B3] gi|421064754|ref|ZP_15526597.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein [Pelosinus fermentans A12] gi|421069298|ref|ZP_15530470.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein [Pelosinus fermentans A11] gi|392438061|gb|EIW15923.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein [Pelosinus fermentans B4] gi|392450318|gb|EIW27371.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein [Pelosinus fermentans A11] gi|392456841|gb|EIW33575.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein [Pelosinus fermentans B3] gi|392460438|gb|EIW36739.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein [Pelosinus fermentans A12] | Back alignment and taxonomy information |
|---|
| >gi|392963323|ref|ZP_10328749.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein [Pelosinus fermentans DSM 17108] gi|392451147|gb|EIW28141.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein [Pelosinus fermentans DSM 17108] | Back alignment and taxonomy information |
|---|
| >gi|363745151|ref|XP_003643208.1| PREDICTED: probable 2-ketogluconate reductase-like, partial [Gallus gallus] | Back alignment and taxonomy information |
|---|
| >gi|193659821|ref|XP_001952060.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase-like isoform 1 [Acyrthosiphon pisum] gi|328704005|ref|XP_003242374.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|427784185|gb|JAA57544.1| Putative d-3-phosphoglycerate dehydrogen [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|260837447|ref|XP_002613715.1| hypothetical protein BRAFLDRAFT_104160 [Branchiostoma floridae] gi|229299104|gb|EEN69724.1| hypothetical protein BRAFLDRAFT_104160 [Branchiostoma floridae] | Back alignment and taxonomy information |
|---|
| >gi|195117570|ref|XP_002003320.1| GI23165 [Drosophila mojavensis] gi|193913895|gb|EDW12762.1| GI23165 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|239789714|dbj|BAH71462.1| ACYPI003712 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 180 | ||||||
| UNIPROTKB|E1BRZ3 | 292 | LOC100858664 "Uncharacterized | 0.444 | 0.273 | 0.587 | 1.7e-20 | |
| UNIPROTKB|E1C320 | 292 | LOC100858664 "Uncharacterized | 0.444 | 0.273 | 0.587 | 1.7e-20 | |
| UNIPROTKB|E1C321 | 284 | LOC100858664 "Uncharacterized | 0.444 | 0.281 | 0.587 | 1.7e-20 | |
| UNIPROTKB|F1NX57 | 345 | GRHPR "Uncharacterized protein | 0.472 | 0.246 | 0.546 | 1.9e-19 | |
| FB|FBgn0037370 | 362 | CG1236 [Drosophila melanogaste | 0.444 | 0.220 | 0.562 | 3.5e-19 | |
| UNIPROTKB|E1BRZ4 | 272 | LOC420808 "Uncharacterized pro | 0.444 | 0.294 | 0.575 | 4e-19 | |
| UNIPROTKB|G3N069 | 328 | LOC515578 "Uncharacterized pro | 0.438 | 0.240 | 0.582 | 8.3e-19 | |
| UNIPROTKB|F1RZA1 | 324 | LOC100157017 "Uncharacterized | 0.444 | 0.246 | 0.575 | 1.1e-18 | |
| UNIPROTKB|E1BRZ5 | 272 | LOC420807 "Uncharacterized pro | 0.444 | 0.294 | 0.562 | 1.7e-18 | |
| UNIPROTKB|Q9UBQ7 | 328 | GRHPR "Glyoxylate reductase/hy | 0.461 | 0.253 | 0.530 | 1e-17 |
| UNIPROTKB|E1BRZ3 LOC100858664 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 242 (90.2 bits), Expect = 1.7e-20, P = 1.7e-20
Identities = 47/80 (58%), Positives = 61/80 (76%)
Query: 50 QSDFIFVTCALTKDTEQLIGRKQFSLMKPTAILINTSRGGLLDQEALVEFLRDKKIGGAG 109
QSDF+ + LT TE+LIG+K+ LMKPTA LIN SRG ++DQ+ALVE L++K I A
Sbjct: 171 QSDFVMLVVNLTPQTEKLIGKKELGLMKPTATLINISRGAVIDQDALVEALQNKTIKAAA 230
Query: 110 LDVMIPEPLPADHPLVQLDN 129
LDV PEPLP +HPL++L+N
Sbjct: 231 LDVTYPEPLPRNHPLLKLNN 250
|
|
| UNIPROTKB|E1C320 LOC100858664 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C321 LOC100858664 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NX57 GRHPR "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0037370 CG1236 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BRZ4 LOC420808 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3N069 LOC515578 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RZA1 LOC100157017 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BRZ5 LOC420807 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UBQ7 GRHPR "Glyoxylate reductase/hydroxypyruvate reductase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 180 | |||
| cd05301 | 309 | cd05301, GDH, D-glycerate dehydrogenase/hydroxypyr | 2e-42 | |
| pfam02826 | 175 | pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydro | 5e-39 | |
| cd12171 | 310 | cd12171, 2-Hacid_dh_10, Putative D-isomer specific | 4e-38 | |
| cd12173 | 304 | cd12173, PGDH_4, Phosphoglycerate dehydrogenases, | 4e-35 | |
| cd12172 | 306 | cd12172, PGDH_like_2, Putative D-3-Phosphoglycerat | 5e-35 | |
| cd05300 | 313 | cd05300, 2-Hacid_dh_1, Putative D-isomer specific | 3e-34 | |
| COG1052 | 324 | COG1052, LdhA, Lactate dehydrogenase and related d | 3e-34 | |
| cd05299 | 312 | cd05299, CtBP_dh, C-terminal binding protein (CtBP | 3e-34 | |
| cd12162 | 307 | cd12162, 2-Hacid_dh_4, Putative D-isomer specific | 7e-34 | |
| cd12159 | 303 | cd12159, 2-Hacid_dh_2, Putative D-isomer specific | 8e-33 | |
| cd12175 | 311 | cd12175, 2-Hacid_dh_11, Putative D-isomer specific | 1e-32 | |
| cd05198 | 302 | cd05198, formate_dh_like, Formate/glycerate and re | 2e-32 | |
| COG0111 | 324 | COG0111, SerA, Phosphoglycerate dehydrogenase and | 5e-32 | |
| cd12177 | 321 | cd12177, 2-Hacid_dh_12, Putative D-isomer specific | 8e-29 | |
| cd12169 | 308 | cd12169, PGDH_like_1, Putative D-3-Phosphoglycerat | 5e-28 | |
| PRK13581 | 526 | PRK13581, PRK13581, D-3-phosphoglycerate dehydroge | 2e-27 | |
| cd05303 | 301 | cd05303, PGDH_2, Phosphoglycerate dehydrogenase (P | 6e-27 | |
| cd12161 | 315 | cd12161, GDH_like_1, Putative glycerate dehydrogen | 6e-27 | |
| cd12167 | 330 | cd12167, 2-Hacid_dh_8, Putative D-isomer specific | 3e-24 | |
| cd12178 | 317 | cd12178, 2-Hacid_dh_13, Putative D-isomer specific | 3e-24 | |
| cd12155 | 314 | cd12155, PGDH_1, Phosphoglycerate Dehydrogenase, 2 | 3e-24 | |
| cd12165 | 314 | cd12165, 2-Hacid_dh_6, Putative D-isomer specific | 6e-24 | |
| cd12168 | 321 | cd12168, Mand_dh_like, D-Mandelate Dehydrogenase-l | 2e-23 | |
| PRK15409 | 323 | PRK15409, PRK15409, bifunctional glyoxylate/hydrox | 2e-23 | |
| cd12183 | 328 | cd12183, LDH_like_2, D-Lactate and related Dehydro | 2e-23 | |
| PRK13243 | 333 | PRK13243, PRK13243, glyoxylate reductase; Reviewed | 5e-23 | |
| TIGR01327 | 525 | TIGR01327, PGDH, D-3-phosphoglycerate dehydrogenas | 2e-22 | |
| PRK06932 | 314 | PRK06932, PRK06932, glycerate dehydrogenase; Provi | 2e-22 | |
| cd12180 | 308 | cd12180, 2-Hacid_dh_15, Putative D-isomer specific | 1e-21 | |
| PRK06487 | 317 | PRK06487, PRK06487, glycerate dehydrogenase; Provi | 1e-21 | |
| cd12163 | 334 | cd12163, 2-Hacid_dh_5, Putative D-isomer specific | 3e-21 | |
| cd12187 | 329 | cd12187, LDH_like_1, D-Lactate and related Dehydro | 3e-20 | |
| PRK08410 | 311 | PRK08410, PRK08410, 2-hydroxyacid dehydrogenase; P | 6e-20 | |
| cd12174 | 305 | cd12174, PGDH_like_3, Putative D-3-Phosphoglycerat | 1e-18 | |
| cd12156 | 301 | cd12156, HPPR, Hydroxy(phenyl)pyruvate Reductase, | 2e-18 | |
| cd12186 | 329 | cd12186, LDH, D-Lactate dehydrogenase and D-2-Hydr | 3e-18 | |
| cd12185 | 322 | cd12185, HGDH_LDH_like, Putative Lactate dehydroge | 5e-18 | |
| cd12176 | 304 | cd12176, PGDH_3, Phosphoglycerate dehydrogenases, | 6e-18 | |
| cd12166 | 300 | cd12166, 2-Hacid_dh_7, Putative D-isomer specific | 1e-17 | |
| cd05302 | 348 | cd05302, FDH, NAD-dependent Formate Dehydrogenase | 2e-17 | |
| cd12164 | 306 | cd12164, GDH_like_2, Putative glycerate dehydrogen | 2e-17 | |
| cd01619 | 323 | cd01619, LDH_like, D-Lactate and related Dehydroge | 2e-17 | |
| PRK11790 | 409 | PRK11790, PRK11790, D-3-phosphoglycerate dehydroge | 4e-16 | |
| PRK07574 | 385 | PRK07574, PRK07574, formate dehydrogenase; Provisi | 5e-16 | |
| pfam00389 | 312 | pfam00389, 2-Hacid_dh, D-isomer specific 2-hydroxy | 8e-15 | |
| cd12157 | 318 | cd12157, PTDH, Thermostable Phosphite Dehydrogenas | 2e-14 | |
| PLN02928 | 347 | PLN02928, PLN02928, oxidoreductase family protein | 9e-14 | |
| cd12160 | 310 | cd12160, 2-Hacid_dh_3, Putative D-isomer specific | 5e-13 | |
| cd12158 | 343 | cd12158, ErythrP_dh, D-Erythronate-4-Phosphate Deh | 4e-12 | |
| cd12184 | 330 | cd12184, HGDH_like, (R)-2-Hydroxyglutarate Dehydro | 3e-11 | |
| PLN02306 | 386 | PLN02306, PLN02306, hydroxypyruvate reductase | 2e-10 | |
| PLN03139 | 386 | PLN03139, PLN03139, formate dehydrogenase; Provisi | 3e-10 | |
| cd12179 | 306 | cd12179, 2-Hacid_dh_14, Putative D-isomer specific | 3e-08 | |
| PRK06436 | 303 | PRK06436, PRK06436, glycerate dehydrogenase; Provi | 5e-07 | |
| PRK00257 | 381 | PRK00257, PRK00257, erythronate-4-phosphate dehydr | 6e-07 | |
| cd12160 | 310 | cd12160, 2-Hacid_dh_3, Putative D-isomer specific | 1e-06 | |
| PRK12480 | 330 | PRK12480, PRK12480, D-lactate dehydrogenase; Provi | 1e-06 | |
| PRK08605 | 332 | PRK08605, PRK08605, D-lactate dehydrogenase; Valid | 3e-05 | |
| PRK15469 | 312 | PRK15469, ghrA, bifunctional glyoxylate/hydroxypyr | 1e-04 | |
| PRK15438 | 378 | PRK15438, PRK15438, erythronate-4-phosphate dehydr | 0.003 |
| >gnl|CDD|240626 cd05301, GDH, D-glycerate dehydrogenase/hydroxypyruvate reductase (GDH) | Back alignment and domain information |
|---|
Score = 143 bits (364), Expect = 2e-42
Identities = 50/82 (60%), Positives = 64/82 (78%)
Query: 49 AQSDFIFVTCALTKDTEQLIGRKQFSLMKPTAILINTSRGGLLDQEALVEFLRDKKIGGA 108
A+SDF+ + C LT +T LI ++ +LMKPTAILINT+RGG++D++ALVE L+ KI GA
Sbjct: 197 AESDFVSLHCPLTPETRHLINAERLALMKPTAILINTARGGVVDEDALVEALKSGKIAGA 256
Query: 109 GLDVMIPEPLPADHPLVQLDNC 130
GLDV PEPLPADHPL+ L N
Sbjct: 257 GLDVFEPEPLPADHPLLTLPNV 278
|
D-glycerate dehydrogenase (GDH, also known as hydroxypyruvate reductase, HPR) catalyzes the reversible reaction of (R)-glycerate + NAD+ to hydroxypyruvate + NADH + H+. In humans, HPR deficiency causes primary hyperoxaluria type 2, characterized by over-excretion of L-glycerate and oxalate in the urine, possibly due to an imbalance in competition with L-lactate dehydrogenase, another formate dehydrogenase (FDH)-like enzyme. GDH, like FDH and other members of the D-specific hydroxyacid dehydrogenase family that also includes L-alanine dehydrogenase and S-adenosylhomocysteine hydrolase, typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann-fold NAD+ binding form, despite often low sequence identity. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomain but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. While many members of this family are dimeric, alanine DH is hexameric and phosphoglycerate DH is tetrameric. Length = 309 |
| >gnl|CDD|217244 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|240648 cd12171, 2-Hacid_dh_10, Putative D-isomer specific 2-hydroxyacid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|240650 cd12173, PGDH_4, Phosphoglycerate dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240649 cd12172, PGDH_like_2, Putative D-3-Phosphoglycerate Dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240625 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 2-hydroxyacid dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|223980 COG1052, LdhA, Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|240624 cd05299, CtBP_dh, C-terminal binding protein (CtBP), D-isomer-specific 2-hydroxyacid dehydrogenases related repressor | Back alignment and domain information |
|---|
| >gnl|CDD|240639 cd12162, 2-Hacid_dh_4, Putative D-isomer specific 2-hydroxyacid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|240636 cd12159, 2-Hacid_dh_2, Putative D-isomer specific 2-hydroxyacid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|240652 cd12175, 2-Hacid_dh_11, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240622 cd05198, formate_dh_like, Formate/glycerate and related dehydrogenases of the D-specific 2-hydroxy acid dehydrogenase family | Back alignment and domain information |
|---|
| >gnl|CDD|223189 COG0111, SerA, Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|240654 cd12177, 2-Hacid_dh_12, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240646 cd12169, PGDH_like_1, Putative D-3-Phosphoglycerate Dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|237436 PRK13581, PRK13581, D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240628 cd05303, PGDH_2, Phosphoglycerate dehydrogenase (PGDH) NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240638 cd12161, GDH_like_1, Putative glycerate dehydrogenase and related proteins of the D-specific 2-hydroxy dehydrogenase family | Back alignment and domain information |
|---|
| >gnl|CDD|240644 cd12167, 2-Hacid_dh_8, Putative D-isomer specific 2-hydroxyacid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|240655 cd12178, 2-Hacid_dh_13, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240632 cd12155, PGDH_1, Phosphoglycerate Dehydrogenase, 2-hydroxyacid dehydrogenase family | Back alignment and domain information |
|---|
| >gnl|CDD|240642 cd12165, 2-Hacid_dh_6, Putative D-isomer specific 2-hydroxyacid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|240645 cd12168, Mand_dh_like, D-Mandelate Dehydrogenase-like dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|185307 PRK15409, PRK15409, bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240659 cd12183, LDH_like_2, D-Lactate and related Dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|183914 PRK13243, PRK13243, glyoxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233358 TIGR01327, PGDH, D-3-phosphoglycerate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|235890 PRK06932, PRK06932, glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240657 cd12180, 2-Hacid_dh_15, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|180588 PRK06487, PRK06487, glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240640 cd12163, 2-Hacid_dh_5, Putative D-isomer specific 2-hydroxyacid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|240663 cd12187, LDH_like_1, D-Lactate and related Dehydrogenase like proteins, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|181414 PRK08410, PRK08410, 2-hydroxyacid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240651 cd12174, PGDH_like_3, Putative D-3-Phosphoglycerate Dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240633 cd12156, HPPR, Hydroxy(phenyl)pyruvate Reductase, D-isomer-specific 2-hydroxyacid-related dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|240662 cd12186, LDH, D-Lactate dehydrogenase and D-2-Hydroxyisocaproic acid dehydrogenase (D-HicDH), NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240661 cd12185, HGDH_LDH_like, Putative Lactate dehydrogenase and (R)-2-Hydroxyglutarate Dehydrogenase-like proteins, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240653 cd12176, PGDH_3, Phosphoglycerate dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240643 cd12166, 2-Hacid_dh_7, Putative D-isomer specific 2-hydroxyacid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|240627 cd05302, FDH, NAD-dependent Formate Dehydrogenase (FDH) | Back alignment and domain information |
|---|
| >gnl|CDD|240641 cd12164, GDH_like_2, Putative glycerate dehydrogenase and related proteins of the D-specific 2-hydroxy dehydrogenase family | Back alignment and domain information |
|---|
| >gnl|CDD|240620 cd01619, LDH_like, D-Lactate and related Dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|236985 PRK11790, PRK11790, D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181041 PRK07574, PRK07574, formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215893 pfam00389, 2-Hacid_dh, D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|240634 cd12157, PTDH, Thermostable Phosphite Dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|215501 PLN02928, PLN02928, oxidoreductase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|240637 cd12160, 2-Hacid_dh_3, Putative D-isomer specific 2-hydroxyacid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|240635 cd12158, ErythrP_dh, D-Erythronate-4-Phosphate Dehydrogenase NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240660 cd12184, HGDH_like, (R)-2-Hydroxyglutarate Dehydrogenase and related dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|177941 PLN02306, PLN02306, hydroxypyruvate reductase | Back alignment and domain information |
|---|
| >gnl|CDD|178684 PLN03139, PLN03139, formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240656 cd12179, 2-Hacid_dh_14, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|235800 PRK06436, PRK06436, glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|166874 PRK00257, PRK00257, erythronate-4-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|240637 cd12160, 2-Hacid_dh_3, Putative D-isomer specific 2-hydroxyacid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|183550 PRK12480, PRK12480, D-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181499 PRK08605, PRK08605, D-lactate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|185366 PRK15469, ghrA, bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185335 PRK15438, PRK15438, erythronate-4-phosphate dehydrogenase PdxB; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 180 | |||
| COG0111 | 324 | SerA Phosphoglycerate dehydrogenase and related de | 99.98 | |
| PRK08410 | 311 | 2-hydroxyacid dehydrogenase; Provisional | 99.97 | |
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 99.97 | |
| PRK06487 | 317 | glycerate dehydrogenase; Provisional | 99.96 | |
| PRK15409 | 323 | bifunctional glyoxylate/hydroxypyruvate reductase | 99.96 | |
| KOG0068|consensus | 406 | 99.96 | ||
| PRK06932 | 314 | glycerate dehydrogenase; Provisional | 99.96 | |
| COG1052 | 324 | LdhA Lactate dehydrogenase and related dehydrogena | 99.96 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 99.96 | |
| PLN02306 | 386 | hydroxypyruvate reductase | 99.95 | |
| PLN02928 | 347 | oxidoreductase family protein | 99.95 | |
| PLN03139 | 386 | formate dehydrogenase; Provisional | 99.94 | |
| PRK15469 | 312 | ghrA bifunctional glyoxylate/hydroxypyruvate reduc | 99.94 | |
| PRK07574 | 385 | formate dehydrogenase; Provisional | 99.94 | |
| TIGR01327 | 525 | PGDH D-3-phosphoglycerate dehydrogenase. This mode | 99.94 | |
| PRK13581 | 526 | D-3-phosphoglycerate dehydrogenase; Provisional | 99.94 | |
| PRK13243 | 333 | glyoxylate reductase; Reviewed | 99.93 | |
| PRK15438 | 378 | erythronate-4-phosphate dehydrogenase PdxB; Provis | 99.92 | |
| PRK06436 | 303 | glycerate dehydrogenase; Provisional | 99.91 | |
| KOG0069|consensus | 336 | 99.91 | ||
| PRK00257 | 381 | erythronate-4-phosphate dehydrogenase; Validated | 99.91 | |
| PRK12480 | 330 | D-lactate dehydrogenase; Provisional | 99.9 | |
| PRK08605 | 332 | D-lactate dehydrogenase; Validated | 99.88 | |
| COG0111 | 324 | SerA Phosphoglycerate dehydrogenase and related de | 99.82 | |
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 99.78 | |
| PRK06932 | 314 | glycerate dehydrogenase; Provisional | 99.77 | |
| PRK06487 | 317 | glycerate dehydrogenase; Provisional | 99.76 | |
| PRK08410 | 311 | 2-hydroxyacid dehydrogenase; Provisional | 99.76 | |
| PRK15409 | 323 | bifunctional glyoxylate/hydroxypyruvate reductase | 99.75 | |
| PLN02928 | 347 | oxidoreductase family protein | 99.74 | |
| PRK07574 | 385 | formate dehydrogenase; Provisional | 99.7 | |
| PLN03139 | 386 | formate dehydrogenase; Provisional | 99.7 | |
| PRK15469 | 312 | ghrA bifunctional glyoxylate/hydroxypyruvate reduc | 99.69 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 99.67 | |
| PRK13243 | 333 | glyoxylate reductase; Reviewed | 99.66 | |
| PLN02306 | 386 | hydroxypyruvate reductase | 99.64 | |
| COG1052 | 324 | LdhA Lactate dehydrogenase and related dehydrogena | 99.64 | |
| PRK13581 | 526 | D-3-phosphoglycerate dehydrogenase; Provisional | 99.6 | |
| TIGR01327 | 525 | PGDH D-3-phosphoglycerate dehydrogenase. This mode | 99.6 | |
| KOG0068|consensus | 406 | 99.56 | ||
| KOG0069|consensus | 336 | 99.55 | ||
| PRK06436 | 303 | glycerate dehydrogenase; Provisional | 99.5 | |
| PRK12480 | 330 | D-lactate dehydrogenase; Provisional | 99.5 | |
| PRK15438 | 378 | erythronate-4-phosphate dehydrogenase PdxB; Provis | 99.48 | |
| PRK00257 | 381 | erythronate-4-phosphate dehydrogenase; Validated | 99.45 | |
| PRK08605 | 332 | D-lactate dehydrogenase; Validated | 99.44 | |
| KOG0067|consensus | 435 | 99.14 | ||
| PTZ00075 | 476 | Adenosylhomocysteinase; Provisional | 98.64 | |
| PLN02494 | 477 | adenosylhomocysteinase | 98.64 | |
| TIGR00936 | 406 | ahcY adenosylhomocysteinase. This enzyme hydrolyze | 98.19 | |
| PRK13403 | 335 | ketol-acid reductoisomerase; Provisional | 98.11 | |
| TIGR02853 | 287 | spore_dpaA dipicolinic acid synthetase, A subunit. | 97.31 | |
| TIGR01505 | 291 | tartro_sem_red 2-hydroxy-3-oxopropionate reductase | 97.17 | |
| PRK11559 | 296 | garR tartronate semialdehyde reductase; Provisiona | 97.15 | |
| PRK05476 | 425 | S-adenosyl-L-homocysteine hydrolase; Provisional | 97.06 | |
| PRK05225 | 487 | ketol-acid reductoisomerase; Validated | 96.73 | |
| PF00670 | 162 | AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase | 96.72 | |
| PRK12490 | 299 | 6-phosphogluconate dehydrogenase-like protein; Rev | 96.3 | |
| PRK15461 | 296 | NADH-dependent gamma-hydroxybutyrate dehydrogenase | 95.98 | |
| TIGR01692 | 288 | HIBADH 3-hydroxyisobutyrate dehydrogenase. This en | 95.73 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 95.66 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 95.37 | |
| PRK09599 | 301 | 6-phosphogluconate dehydrogenase-like protein; Rev | 95.36 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 95.31 | |
| PLN02712 | 667 | arogenate dehydrogenase | 94.49 | |
| PRK05479 | 330 | ketol-acid reductoisomerase; Provisional | 94.45 | |
| TIGR01724 | 341 | hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome | 94.17 | |
| COG2084 | 286 | MmsB 3-hydroxyisobutyrate dehydrogenase and relate | 93.83 | |
| PRK09287 | 459 | 6-phosphogluconate dehydrogenase; Validated | 92.93 | |
| PLN02350 | 493 | phosphogluconate dehydrogenase (decarboxylating) | 92.87 | |
| PLN02858 | 1378 | fructose-bisphosphate aldolase | 92.79 | |
| PRK15059 | 292 | tartronate semialdehyde reductase; Provisional | 92.55 | |
| PLN02712 | 667 | arogenate dehydrogenase | 92.16 | |
| PTZ00142 | 470 | 6-phosphogluconate dehydrogenase; Provisional | 92.02 | |
| PLN02256 | 304 | arogenate dehydrogenase | 91.4 | |
| PRK14619 | 308 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 91.0 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 90.85 | |
| PRK11199 | 374 | tyrA bifunctional chorismate mutase/prephenate deh | 90.73 | |
| PLN02858 | 1378 | fructose-bisphosphate aldolase | 90.31 | |
| PRK14189 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 89.84 | |
| PTZ00075 | 476 | Adenosylhomocysteinase; Provisional | 89.7 | |
| COG0499 | 420 | SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me | 88.95 | |
| PRK08655 | 437 | prephenate dehydrogenase; Provisional | 88.5 | |
| PRK08818 | 370 | prephenate dehydrogenase; Provisional | 88.49 | |
| KOG0067|consensus | 435 | 87.99 | ||
| PRK12557 | 342 | H(2)-dependent methylenetetrahydromethanopterin de | 87.76 | |
| KOG1370|consensus | 434 | 87.71 | ||
| PLN02494 | 477 | adenosylhomocysteinase | 87.65 | |
| cd05212 | 140 | NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom | 86.23 | |
| TIGR00872 | 298 | gnd_rel 6-phosphogluconate dehydrogenase (decarbox | 84.91 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 84.52 | |
| TIGR00873 | 467 | gnd 6-phosphogluconate dehydrogenase, decarboxylat | 84.49 | |
| PF05222 | 136 | AlaDh_PNT_N: Alanine dehydrogenase/PNT, N-terminal | 84.07 | |
| TIGR01546 | 333 | GAPDH-II_archae glyceraldehyde-3-phosphate dehydro | 81.76 | |
| TIGR03026 | 411 | NDP-sugDHase nucleotide sugar dehydrogenase. All o | 80.21 |
| >COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Probab=99.98 E-value=1.5e-32 Score=232.16 Aligned_cols=123 Identities=37% Similarity=0.497 Sum_probs=113.4
Q ss_pred cCCcccc-----ceeeeEEEeccccccC---CccceeeccCHHHHhccCCEEEEccCCCCCCcceeCHhHHhccCCCcEE
Q psy5266 11 TGTPGQV-----HLIVCVLIRYHVDLTG---GSKQVYLILVIRTRSAQSDFIFVTCALTKDTEQLIGRKQFSLMKPTAIL 82 (180)
Q Consensus 11 ~G~iG~~-----~~~~~~~~~~~~~~~~---~~~~~~~~~~l~~l~~~~D~v~~h~pl~~~T~glIg~~~i~~mk~g~~l 82 (180)
.|+||+. ..|||++++||+.... ...+.+...+|++++++||||++|+|+|++|+||||++.|++||+|+++
T Consensus 150 ~G~IG~~va~~l~afgm~v~~~d~~~~~~~~~~~~~~~~~~Ld~lL~~sDiv~lh~PlT~eT~g~i~~~~~a~MK~gail 229 (324)
T COG0111 150 LGRIGRAVAKRLKAFGMKVIGYDPYSPRERAGVDGVVGVDSLDELLAEADILTLHLPLTPETRGLINAEELAKMKPGAIL 229 (324)
T ss_pred CCHHHHHHHHHHHhCCCeEEEECCCCchhhhccccceecccHHHHHhhCCEEEEcCCCCcchhcccCHHHHhhCCCCeEE
Confidence 7888885 4789999999995554 2344667889999999999999999999999999999999999999999
Q ss_pred EecCCCCccCHHHHHHHHhcCCcceEEeecCCCCCCCCCCCCCCCCceeec
Q psy5266 83 INTSRGGLLDQEALVEFLRDKKIGGAGLDVMIPEPLPADHPLVQLDNCGNG 133 (180)
Q Consensus 83 vn~~Rg~~vd~~al~~~L~~~~i~~~~lDv~~~ep~~~~~~l~~~~Nv~~g 133 (180)
||++||++||+++|.++|++|+|.+|+||||++||++.++|||.+|||++|
T Consensus 230 IN~aRG~vVde~aL~~AL~~G~i~gA~lDVf~~EPl~~~~pL~~~pnV~~T 280 (324)
T COG0111 230 INAARGGVVDEDALLAALDSGKIAGAALDVFEEEPLPADSPLWDLPNVILT 280 (324)
T ss_pred EECCCcceecHHHHHHHHHcCCcceEEecCCCCCCCCCCChhhcCCCeEEC
Confidence 999999999999999999999999999999999999999999999999986
|
|
| >PRK08410 2-hydroxyacid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >PRK06487 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional | Back alignment and domain information |
|---|
| >KOG0068|consensus | Back alignment and domain information |
|---|
| >PRK06932 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02306 hydroxypyruvate reductase | Back alignment and domain information |
|---|
| >PLN02928 oxidoreductase family protein | Back alignment and domain information |
|---|
| >PLN03139 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional | Back alignment and domain information |
|---|
| >PRK07574 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase | Back alignment and domain information |
|---|
| >PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13243 glyoxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional | Back alignment and domain information |
|---|
| >PRK06436 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG0069|consensus | Back alignment and domain information |
|---|
| >PRK00257 erythronate-4-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12480 D-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08605 D-lactate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >PRK06932 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06487 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08410 2-hydroxyacid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional | Back alignment and domain information |
|---|
| >PLN02928 oxidoreductase family protein | Back alignment and domain information |
|---|
| >PRK07574 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN03139 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13243 glyoxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PLN02306 hydroxypyruvate reductase | Back alignment and domain information |
|---|
| >COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase | Back alignment and domain information |
|---|
| >KOG0068|consensus | Back alignment and domain information |
|---|
| >KOG0069|consensus | Back alignment and domain information |
|---|
| >PRK06436 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12480 D-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional | Back alignment and domain information |
|---|
| >PRK00257 erythronate-4-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08605 D-lactate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG0067|consensus | Back alignment and domain information |
|---|
| >PTZ00075 Adenosylhomocysteinase; Provisional | Back alignment and domain information |
|---|
| >PLN02494 adenosylhomocysteinase | Back alignment and domain information |
|---|
| >TIGR00936 ahcY adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PRK13403 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit | Back alignment and domain information |
|---|
| >TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase | Back alignment and domain information |
|---|
| >PRK11559 garR tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK05225 ketol-acid reductoisomerase; Validated | Back alignment and domain information |
|---|
| >PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 | Back alignment and domain information |
|---|
| >PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PLN02712 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PRK05479 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein | Back alignment and domain information |
|---|
| >COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK09287 6-phosphogluconate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02350 phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >PLN02858 fructose-bisphosphate aldolase | Back alignment and domain information |
|---|
| >PRK15059 tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02712 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PTZ00142 6-phosphogluconate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02256 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02858 fructose-bisphosphate aldolase | Back alignment and domain information |
|---|
| >PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PTZ00075 Adenosylhomocysteinase; Provisional | Back alignment and domain information |
|---|
| >COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK08655 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08818 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG0067|consensus | Back alignment and domain information |
|---|
| >PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional | Back alignment and domain information |
|---|
| >KOG1370|consensus | Back alignment and domain information |
|---|
| >PLN02494 adenosylhomocysteinase | Back alignment and domain information |
|---|
| >cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating | Back alignment and domain information |
|---|
| >PF05222 AlaDh_PNT_N: Alanine dehydrogenase/PNT, N-terminal domain; InterPro: IPR007886 Alanine dehydrogenases (1 | Back alignment and domain information |
|---|
| >TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II | Back alignment and domain information |
|---|
| >TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 180 | ||||
| 2gcg_A | 330 | Ternary Crystal Structure Of Human Glyoxylate Reduc | 3e-19 | ||
| 2h1s_A | 328 | Crystal Structure Of A GlyoxylateHYDROXYPYRUVATE RE | 2e-18 | ||
| 1wwk_A | 307 | Crystal Structure Of Phosphoglycerate Dehydrogenase | 2e-17 | ||
| 2cuk_A | 311 | Crystal Structure Of Tt0316 Protein From Thermus Th | 1e-14 | ||
| 2dbr_A | 334 | Crystal Structure Of Glyoxylate Reductase (Ph0597) | 2e-13 | ||
| 2dbq_A | 334 | Crystal Structure Of Glyoxylate Reductase (Ph0597) | 9e-13 | ||
| 3hg7_A | 324 | Crystal Structure Of D-Isomer Specific 2-Hydroxyaci | 3e-11 | ||
| 3fn4_A | 401 | Apo-form Of Nad-dependent Formate Dehydrogenase Fro | 4e-11 | ||
| 2gsd_A | 402 | Nad-dependent Formate Dehydrogenase From Bacterium | 4e-11 | ||
| 2nac_A | 393 | High Resolution Structures Of Holo And Apo Formate | 4e-10 | ||
| 2go1_A | 401 | Nad-Dependent Formate Dehydrogenase From Pseudomona | 5e-10 | ||
| 2gug_A | 401 | Nad-dependent Formate Dehydrogenase From Pseudomona | 5e-10 | ||
| 2p9c_A | 410 | Crystal Structure Of Serine Bound G336v Mutant Of E | 6e-10 | ||
| 2p9g_A | 410 | Crystal Structure Of Serine Bound G336v,G337v Doubl | 6e-10 | ||
| 3gg9_A | 352 | Crystal Structure Of Putative D-3-Phosphoglycerate | 1e-09 | ||
| 1psd_A | 409 | The Allosteric Ligand Site In The Vmax-Type Coopera | 2e-09 | ||
| 3evt_A | 324 | Crystal Structure Of Phosphoglycerate Dehydrogenase | 2e-09 | ||
| 3evt_A | 324 | Crystal Structure Of Phosphoglycerate Dehydrogenase | 2e-04 | ||
| 3ba1_A | 333 | Structure Of Hydroxyphenylpyruvate Reductase From C | 2e-09 | ||
| 2j6i_A | 364 | Candida Boidinii Formate Dehydrogenase (Fdh) C-Term | 2e-09 | ||
| 2fss_A | 365 | Candida Boidinii Formate Dehydrogenase (Fdh) K47e M | 2e-09 | ||
| 3ddn_A | 528 | Crystal Structure Of Hydroxypyruvic Acid Phosphate | 4e-09 | ||
| 1ygy_A | 529 | Crystal Structure Of D-3-Phosphoglycerate Dehydroge | 4e-09 | ||
| 2yq4_A | 343 | Crystal Structure Of D-isomer Specific 2-hydroxyaci | 5e-09 | ||
| 1hl3_A | 358 | CtbpBARS IN TERNARY COMPLEX WITH NAD(H) AND PIDLSKK | 9e-09 | ||
| 3ga0_A | 358 | Ctbp1BARS GLY172->glu Mutant Structure: Impairing N | 9e-09 | ||
| 1hku_A | 358 | CtbpBARS: A DUAL-Function Protein Involved In Trans | 9e-09 | ||
| 2ome_A | 336 | Crystal Structure Of Human Ctbp2 Dehydrogenase Comp | 9e-09 | ||
| 1mx3_A | 347 | Crystal Structure Of Ctbp Dehydrogenase Core Holo F | 1e-08 | ||
| 1sc6_A | 404 | Crystal Structure Of W139g D-3-Phosphoglycerate Deh | 2e-08 | ||
| 3naq_A | 357 | Apo-Form Of Nad-Dependent Formate Dehydrogenase Fro | 3e-08 | ||
| 3n7u_A | 351 | Nad-Dependent Formate Dehydrogenase From Higher-Pla | 3e-08 | ||
| 4dgs_A | 340 | The Crystals Structure Of Dehydrogenase From Rhizob | 3e-08 | ||
| 1yba_A | 410 | The Active Form Of Phosphoglycerate Dehydrogenase L | 4e-08 | ||
| 4hy3_A | 365 | Crystal Structure Of A Phosphoglycerate Oxidoreduct | 1e-07 | ||
| 2w2k_A | 348 | Crystal Structure Of The Apo Forms Of Rhodotorula G | 4e-07 | ||
| 2w2l_D | 348 | Crystal Structure Of The Holo Forms Of Rhodotorula | 4e-07 | ||
| 2w2k_B | 348 | Crystal Structure Of The Apo Forms Of Rhodotorula G | 4e-07 | ||
| 4ebf_A | 334 | Semet Thermostable Phosphite Dehydrogenase Glu175-A | 7e-07 | ||
| 4e5m_A | 329 | Thermostable Phosphite Dehydrogenase E175aA176R IN | 8e-07 | ||
| 4e5k_A | 329 | Thermostable Phosphite Dehydrogenase In Complex Wit | 8e-07 | ||
| 4e5p_A | 332 | Thermostable Phosphite Dehydrogenase A176r Variant | 9e-07 | ||
| 4e5n_A | 330 | Thermostable Phosphite Dehydrogenase In Complex Wit | 9e-07 | ||
| 2g76_A | 335 | Crystal Structure Of Human 3-Phosphoglycerate Dehyd | 1e-06 | ||
| 1dxy_A | 333 | Structure Of D-2-Hydroxyisocaproate Dehydrogenase L | 1e-06 | ||
| 2ekl_A | 313 | Structure Of St1218 Protein From Sulfolobus Tokodai | 2e-06 | ||
| 1xdw_A | 331 | Nad+-Dependent (R)-2-Hydroxyglutarate Dehydrogenase | 4e-06 | ||
| 3k5p_A | 416 | Crystal Structure Of Amino Acid-Binding Act: D-Isom | 4e-06 | ||
| 3kb6_A | 334 | Crystal Structure Of D-lactate Dehydrogenase From A | 6e-06 | ||
| 2d0i_A | 333 | Crystal Structure Ph0520 Protein From Pyrococcus Ho | 4e-05 | ||
| 4g2n_A | 345 | Crystal Structure Of Putative D-Isomer Specific 2-H | 5e-05 | ||
| 1gdh_A | 320 | Crystal Structure Of A Nad-Dependent D-Glycerate De | 4e-04 |
| >pdb|2GCG|A Chain A, Ternary Crystal Structure Of Human Glyoxylate ReductaseHYDROXYPYRUVATE REDUCTASE Length = 330 | Back alignment and structure |
|
| >pdb|2H1S|A Chain A, Crystal Structure Of A GlyoxylateHYDROXYPYRUVATE REDUCTASE FROM HOMO Sapiens Length = 328 | Back alignment and structure |
| >pdb|1WWK|A Chain A, Crystal Structure Of Phosphoglycerate Dehydrogenase From Pyrococcus Horikoshii Ot3 Length = 307 | Back alignment and structure |
| >pdb|2CUK|A Chain A, Crystal Structure Of Tt0316 Protein From Thermus Thermophilus Hb8 Length = 311 | Back alignment and structure |
| >pdb|2DBR|A Chain A, Crystal Structure Of Glyoxylate Reductase (Ph0597) From Pyrococcus Horikoshii Ot3, Complexed With Nadp (P1) Length = 334 | Back alignment and structure |
| >pdb|2DBQ|A Chain A, Crystal Structure Of Glyoxylate Reductase (Ph0597) From Pyrococcus Horikoshii Ot3, Complexed With Nadp (I41) Length = 334 | Back alignment and structure |
| >pdb|3HG7|A Chain A, Crystal Structure Of D-Isomer Specific 2-Hydroxyacid Dehydrogenase Family Protein From Aeromonas Salmonicida Subsp. Salmonicida A449 Length = 324 | Back alignment and structure |
| >pdb|3FN4|A Chain A, Apo-form Of Nad-dependent Formate Dehydrogenase From Bacterium Moraxella Sp.c-1 In Closed Conformation Length = 401 | Back alignment and structure |
| >pdb|2GSD|A Chain A, Nad-dependent Formate Dehydrogenase From Bacterium Moraxella Sp.c2 In Complex With Nad And Azide Length = 402 | Back alignment and structure |
| >pdb|2NAC|A Chain A, High Resolution Structures Of Holo And Apo Formate Dehydrogenase Length = 393 | Back alignment and structure |
| >pdb|2GO1|A Chain A, Nad-Dependent Formate Dehydrogenase From Pseudomonas Sp.101 Length = 401 | Back alignment and structure |
| >pdb|2GUG|A Chain A, Nad-dependent Formate Dehydrogenase From Pseudomonas Sp.101 In Complex With Formate Length = 401 | Back alignment and structure |
| >pdb|2P9C|A Chain A, Crystal Structure Of Serine Bound G336v Mutant Of E.Coli Phosphoglycerate Dehydrogenase Length = 410 | Back alignment and structure |
| >pdb|2P9G|A Chain A, Crystal Structure Of Serine Bound G336v,G337v Double Mutant Of E.Coli Phosphoglycerate Dehydrogenase Length = 410 | Back alignment and structure |
| >pdb|3GG9|A Chain A, Crystal Structure Of Putative D-3-Phosphoglycerate Dehydrogenase Oxidoreductase From Ralstonia Solanacearum Length = 352 | Back alignment and structure |
| >pdb|1PSD|A Chain A, The Allosteric Ligand Site In The Vmax-Type Cooperative Enzyme Phosphoglycerate Dehydrogenase Length = 409 | Back alignment and structure |
| >pdb|3EVT|A Chain A, Crystal Structure Of Phosphoglycerate Dehydrogenase From Lactobacillus Plantarum Length = 324 | Back alignment and structure |
| >pdb|3EVT|A Chain A, Crystal Structure Of Phosphoglycerate Dehydrogenase From Lactobacillus Plantarum Length = 324 | Back alignment and structure |
| >pdb|3BA1|A Chain A, Structure Of Hydroxyphenylpyruvate Reductase From Coleus Blu Length = 333 | Back alignment and structure |
| >pdb|2J6I|A Chain A, Candida Boidinii Formate Dehydrogenase (Fdh) C-Terminal Mutant Length = 364 | Back alignment and structure |
| >pdb|2FSS|A Chain A, Candida Boidinii Formate Dehydrogenase (Fdh) K47e Mutant Length = 365 | Back alignment and structure |
| >pdb|3DDN|A Chain A, Crystal Structure Of Hydroxypyruvic Acid Phosphate Bound D-3- Phosphoglycerate Dehydrogenase In Mycobacterium Tuberculosis Length = 528 | Back alignment and structure |
| >pdb|1YGY|A Chain A, Crystal Structure Of D-3-Phosphoglycerate Dehydrogenase From Mycobacterium Tuberculosis Length = 529 | Back alignment and structure |
| >pdb|2YQ4|A Chain A, Crystal Structure Of D-isomer Specific 2-hydroxyacid Dehydrogenase From Lactobacillus Delbrueckii Ssp. Bulgaricus Length = 343 | Back alignment and structure |
| >pdb|1HL3|A Chain A, CtbpBARS IN TERNARY COMPLEX WITH NAD(H) AND PIDLSKK PEPTIDE Length = 358 | Back alignment and structure |
| >pdb|3GA0|A Chain A, Ctbp1BARS GLY172->glu Mutant Structure: Impairing Nad(H) Binding And Dimerization Length = 358 | Back alignment and structure |
| >pdb|1HKU|A Chain A, CtbpBARS: A DUAL-Function Protein Involved In Transcription Corepression And Golgi Membrane Fission Length = 358 | Back alignment and structure |
| >pdb|2OME|A Chain A, Crystal Structure Of Human Ctbp2 Dehydrogenase Complexed With Nad(H) Length = 336 | Back alignment and structure |
| >pdb|1MX3|A Chain A, Crystal Structure Of Ctbp Dehydrogenase Core Holo Form Length = 347 | Back alignment and structure |
| >pdb|1SC6|A Chain A, Crystal Structure Of W139g D-3-Phosphoglycerate Dehydrogenase Complexed With Nad+ Length = 404 | Back alignment and structure |
| >pdb|3NAQ|A Chain A, Apo-Form Of Nad-Dependent Formate Dehydrogenase From Higher-Plant Arabidopsis Thaliana Length = 357 | Back alignment and structure |
| >pdb|3N7U|A Chain A, Nad-Dependent Formate Dehydrogenase From Higher-Plant Arabid Thaliana In Complex With Nad And Azide Length = 351 | Back alignment and structure |
| >pdb|4DGS|A Chain A, The Crystals Structure Of Dehydrogenase From Rhizobium Meliloti Length = 340 | Back alignment and structure |
| >pdb|1YBA|A Chain A, The Active Form Of Phosphoglycerate Dehydrogenase Length = 410 | Back alignment and structure |
| >pdb|4HY3|A Chain A, Crystal Structure Of A Phosphoglycerate Oxidoreductase From Rhizobium Etli Length = 365 | Back alignment and structure |
| >pdb|2W2K|A Chain A, Crystal Structure Of The Apo Forms Of Rhodotorula Graminis D-Mandelate Dehydrogenase At 1.8a. Length = 348 | Back alignment and structure |
| >pdb|2W2L|D Chain D, Crystal Structure Of The Holo Forms Of Rhodotorula Graminis D-Mandelate Dehydrogenase At 2.5a Length = 348 | Back alignment and structure |
| >pdb|2W2K|B Chain B, Crystal Structure Of The Apo Forms Of Rhodotorula Graminis D-Mandelate Dehydrogenase At 1.8a Length = 348 | Back alignment and structure |
| >pdb|4EBF|A Chain A, Semet Thermostable Phosphite Dehydrogenase Glu175-Ala Mutant Length = 334 | Back alignment and structure |
| >pdb|4E5M|A Chain A, Thermostable Phosphite Dehydrogenase E175aA176R IN COMPLEX WITH NADP Length = 329 | Back alignment and structure |
| >pdb|4E5K|A Chain A, Thermostable Phosphite Dehydrogenase In Complex With Nad And Sulfite Length = 329 | Back alignment and structure |
| >pdb|4E5P|A Chain A, Thermostable Phosphite Dehydrogenase A176r Variant In Complex With Nad Length = 332 | Back alignment and structure |
| >pdb|4E5N|A Chain A, Thermostable Phosphite Dehydrogenase In Complex With Nad Length = 330 | Back alignment and structure |
| >pdb|2G76|A Chain A, Crystal Structure Of Human 3-Phosphoglycerate Dehydrogenase Length = 335 | Back alignment and structure |
| >pdb|1DXY|A Chain A, Structure Of D-2-Hydroxyisocaproate Dehydrogenase Length = 333 | Back alignment and structure |
| >pdb|2EKL|A Chain A, Structure Of St1218 Protein From Sulfolobus Tokodaii Length = 313 | Back alignment and structure |
| >pdb|1XDW|A Chain A, Nad+-Dependent (R)-2-Hydroxyglutarate Dehydrogenase From Acidaminococcus Fermentans Length = 331 | Back alignment and structure |
| >pdb|3K5P|A Chain A, Crystal Structure Of Amino Acid-Binding Act: D-Isomer Specific 2- Hydroxyacid Dehydrogenase Catalytic Domain From Brucella Melitensis Length = 416 | Back alignment and structure |
| >pdb|3KB6|A Chain A, Crystal Structure Of D-lactate Dehydrogenase From Aquifex Aeolicus Complexed With Nad And Lactic Acid Length = 334 | Back alignment and structure |
| >pdb|2D0I|A Chain A, Crystal Structure Ph0520 Protein From Pyrococcus Horikoshii Ot3 Length = 333 | Back alignment and structure |
| >pdb|4G2N|A Chain A, Crystal Structure Of Putative D-Isomer Specific 2-Hydroxyacid Dehydrogenase, Nad-Binding From Polaromonas Sp. Js6 66 Length = 345 | Back alignment and structure |
| >pdb|1GDH|A Chain A, Crystal Structure Of A Nad-Dependent D-Glycerate Dehydrogenase At 2.4 Angstroms Resolution Length = 320 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 180 | |||
| 2gcg_A | 330 | Glyoxylate reductase/hydroxypyruvate reductase; NA | 5e-41 | |
| 2cuk_A | 311 | Glycerate dehydrogenase/glyoxylate reductase; stru | 2e-38 | |
| 1qp8_A | 303 | Formate dehydrogenase; oxidoreductase; HET: NDP; 2 | 5e-38 | |
| 2dbq_A | 334 | Glyoxylate reductase; D-3-phosphoglycerate dehydro | 7e-38 | |
| 1gdh_A | 320 | D-glycerate dehydrogenase; oxidoreductase(CHOH (D) | 2e-37 | |
| 3evt_A | 324 | Phosphoglycerate dehydrogenase; structural genomic | 5e-37 | |
| 3gg9_A | 352 | D-3-phosphoglycerate dehydrogenase oxidoreductase; | 3e-36 | |
| 4g2n_A | 345 | D-isomer specific 2-hydroxyacid dehydrogenase, Na; | 7e-36 | |
| 4e5n_A | 330 | Thermostable phosphite dehydrogenase; D-2-hydroxya | 4e-35 | |
| 2nac_A | 393 | NAD-dependent formate dehydrogenase; oxidoreductas | 5e-35 | |
| 1wwk_A | 307 | Phosphoglycerate dehydrogenase; riken structural g | 5e-33 | |
| 3jtm_A | 351 | Formate dehydrogenase, mitochondrial; mitochondrio | 7e-33 | |
| 3gvx_A | 290 | Glycerate dehydrogenase related protein; NYSGXRC, | 8e-33 | |
| 1mx3_A | 347 | CTBP1, C-terminal binding protein 1; nuclear prote | 9e-33 | |
| 2j6i_A | 364 | Formate dehydrogenase; oxidoreductase, D-specific- | 1e-32 | |
| 2w2k_A | 348 | D-mandelate dehydrogenase; 2-hydroxyacid dehydroge | 4e-32 | |
| 2d0i_A | 333 | Dehydrogenase; structural genomics, NPPSFA, nation | 5e-31 | |
| 3ba1_A | 333 | HPPR, hydroxyphenylpyruvate reductase; two domain | 5e-31 | |
| 4dgs_A | 340 | Dehydrogenase; structural genomics, PSI-biology, N | 5e-30 | |
| 2g76_A | 335 | 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor | 1e-29 | |
| 3hg7_A | 324 | D-isomer specific 2-hydroxyacid dehydrogenase FAM | 2e-29 | |
| 3pp8_A | 315 | Glyoxylate/hydroxypyruvate reductase A; structural | 1e-28 | |
| 2ekl_A | 313 | D-3-phosphoglycerate dehydrogenase; structural gen | 3e-28 | |
| 2pi1_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 8e-28 | |
| 1j4a_A | 333 | D-LDH, D-lactate dehydrogenase; NAD-dependent dehy | 2e-27 | |
| 1dxy_A | 333 | D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc | 2e-26 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 3e-26 | |
| 1xdw_A | 331 | NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas | 7e-26 | |
| 3k5p_A | 416 | D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, | 7e-26 | |
| 1sc6_A | 404 | PGDH, D-3-phosphoglycerate dehydrogenase; alloster | 2e-25 | |
| 3oet_A | 381 | Erythronate-4-phosphate dehydrogenase; structural | 9e-23 | |
| 2o4c_A | 380 | Erythronate-4-phosphate dehydrogenase; erythronate | 6e-21 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 6e-04 |
| >2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Length = 330 | Back alignment and structure |
|---|
Score = 139 bits (353), Expect = 5e-41
Identities = 44/82 (53%), Positives = 54/82 (65%)
Query: 49 AQSDFIFVTCALTKDTEQLIGRKQFSLMKPTAILINTSRGGLLDQEALVEFLRDKKIGGA 108
AQSDFI V C+LT TE L + F MK TA+ IN SRG +++Q+ L + L KI A
Sbjct: 209 AQSDFIVVACSLTPATEGLCNKDFFQKMKETAVFINISRGDVVNQDDLYQALASGKIAAA 268
Query: 109 GLDVMIPEPLPADHPLVQLDNC 130
GLDV PEPLP +HPL+ L NC
Sbjct: 269 GLDVTSPEPLPTNHPLLTLKNC 290
|
| >2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Length = 311 | Back alignment and structure |
|---|
| >1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Length = 303 | Back alignment and structure |
|---|
| >2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Length = 334 | Back alignment and structure |
|---|
| >1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Length = 320 | Back alignment and structure |
|---|
| >3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Length = 324 | Back alignment and structure |
|---|
| >3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Length = 352 | Back alignment and structure |
|---|
| >4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Length = 345 | Back alignment and structure |
|---|
| >4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Length = 330 | Back alignment and structure |
|---|
| >2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Length = 393 | Back alignment and structure |
|---|
| >1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Length = 307 | Back alignment and structure |
|---|
| >3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Length = 351 | Back alignment and structure |
|---|
| >3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Length = 290 | Back alignment and structure |
|---|
| >1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Length = 347 | Back alignment and structure |
|---|
| >2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Length = 364 | Back alignment and structure |
|---|
| >2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Length = 348 | Back alignment and structure |
|---|
| >2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Length = 333 | Back alignment and structure |
|---|
| >3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Length = 333 | Back alignment and structure |
|---|
| >4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Length = 340 | Back alignment and structure |
|---|
| >2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Length = 335 | Back alignment and structure |
|---|
| >3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Length = 324 | Back alignment and structure |
|---|
| >3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Length = 315 | Back alignment and structure |
|---|
| >2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Length = 313 | Back alignment and structure |
|---|
| >1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Length = 333 | Back alignment and structure |
|---|
| >1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Length = 333 | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Length = 529 | Back alignment and structure |
|---|
| >1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Length = 331 | Back alignment and structure |
|---|
| >3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Length = 416 | Back alignment and structure |
|---|
| >1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Length = 404 | Back alignment and structure |
|---|
| >3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Length = 381 | Back alignment and structure |
|---|
| >2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Length = 380 | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Length = 293 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 180 | |||
| 3kb6_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 99.96 | |
| 3k5p_A | 416 | D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, | 99.94 | |
| 3hg7_A | 324 | D-isomer specific 2-hydroxyacid dehydrogenase FAM | 99.94 | |
| 3pp8_A | 315 | Glyoxylate/hydroxypyruvate reductase A; structural | 99.94 | |
| 3evt_A | 324 | Phosphoglycerate dehydrogenase; structural genomic | 99.93 | |
| 4g2n_A | 345 | D-isomer specific 2-hydroxyacid dehydrogenase, Na; | 99.93 | |
| 3jtm_A | 351 | Formate dehydrogenase, mitochondrial; mitochondrio | 99.93 | |
| 2yq5_A | 343 | D-isomer specific 2-hydroxyacid dehydrogenase; oxi | 99.93 | |
| 4hy3_A | 365 | Phosphoglycerate oxidoreductase; PSI-biology, stru | 99.93 | |
| 1sc6_A | 404 | PGDH, D-3-phosphoglycerate dehydrogenase; alloster | 99.93 | |
| 3gg9_A | 352 | D-3-phosphoglycerate dehydrogenase oxidoreductase; | 99.92 | |
| 2pi1_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 99.92 | |
| 4dgs_A | 340 | Dehydrogenase; structural genomics, PSI-biology, N | 99.91 | |
| 4e5n_A | 330 | Thermostable phosphite dehydrogenase; D-2-hydroxya | 99.91 | |
| 2nac_A | 393 | NAD-dependent formate dehydrogenase; oxidoreductas | 99.9 | |
| 2j6i_A | 364 | Formate dehydrogenase; oxidoreductase, D-specific- | 99.9 | |
| 1dxy_A | 333 | D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc | 99.9 | |
| 1xdw_A | 331 | NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas | 99.9 | |
| 3gvx_A | 290 | Glycerate dehydrogenase related protein; NYSGXRC, | 99.9 | |
| 1j4a_A | 333 | D-LDH, D-lactate dehydrogenase; NAD-dependent dehy | 99.89 | |
| 1qp8_A | 303 | Formate dehydrogenase; oxidoreductase; HET: NDP; 2 | 99.89 | |
| 3oet_A | 381 | Erythronate-4-phosphate dehydrogenase; structural | 99.88 | |
| 2g76_A | 335 | 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor | 99.88 | |
| 1mx3_A | 347 | CTBP1, C-terminal binding protein 1; nuclear prote | 99.88 | |
| 1wwk_A | 307 | Phosphoglycerate dehydrogenase; riken structural g | 99.88 | |
| 2cuk_A | 311 | Glycerate dehydrogenase/glyoxylate reductase; stru | 99.87 | |
| 1gdh_A | 320 | D-glycerate dehydrogenase; oxidoreductase(CHOH (D) | 99.86 | |
| 2ekl_A | 313 | D-3-phosphoglycerate dehydrogenase; structural gen | 99.85 | |
| 2o4c_A | 380 | Erythronate-4-phosphate dehydrogenase; erythronate | 99.85 | |
| 3ba1_A | 333 | HPPR, hydroxyphenylpyruvate reductase; two domain | 99.84 | |
| 2w2k_A | 348 | D-mandelate dehydrogenase; 2-hydroxyacid dehydroge | 99.83 | |
| 2d0i_A | 333 | Dehydrogenase; structural genomics, NPPSFA, nation | 99.79 | |
| 2gcg_A | 330 | Glyoxylate reductase/hydroxypyruvate reductase; NA | 99.78 | |
| 2dbq_A | 334 | Glyoxylate reductase; D-3-phosphoglycerate dehydro | 99.77 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 99.76 | |
| 3hg7_A | 324 | D-isomer specific 2-hydroxyacid dehydrogenase FAM | 99.71 | |
| 3pp8_A | 315 | Glyoxylate/hydroxypyruvate reductase A; structural | 99.71 | |
| 3kb6_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 99.69 | |
| 3jtm_A | 351 | Formate dehydrogenase, mitochondrial; mitochondrio | 99.66 | |
| 3evt_A | 324 | Phosphoglycerate dehydrogenase; structural genomic | 99.66 | |
| 4g2n_A | 345 | D-isomer specific 2-hydroxyacid dehydrogenase, Na; | 99.66 | |
| 4hy3_A | 365 | Phosphoglycerate oxidoreductase; PSI-biology, stru | 99.63 | |
| 3gg9_A | 352 | D-3-phosphoglycerate dehydrogenase oxidoreductase; | 99.61 | |
| 4e5n_A | 330 | Thermostable phosphite dehydrogenase; D-2-hydroxya | 99.59 | |
| 2j6i_A | 364 | Formate dehydrogenase; oxidoreductase, D-specific- | 99.58 | |
| 3k5p_A | 416 | D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, | 99.56 | |
| 2yq5_A | 343 | D-isomer specific 2-hydroxyacid dehydrogenase; oxi | 99.56 | |
| 2pi1_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 99.56 | |
| 2nac_A | 393 | NAD-dependent formate dehydrogenase; oxidoreductas | 99.56 | |
| 4dgs_A | 340 | Dehydrogenase; structural genomics, PSI-biology, N | 99.55 | |
| 1sc6_A | 404 | PGDH, D-3-phosphoglycerate dehydrogenase; alloster | 99.51 | |
| 1j4a_A | 333 | D-LDH, D-lactate dehydrogenase; NAD-dependent dehy | 99.5 | |
| 1wwk_A | 307 | Phosphoglycerate dehydrogenase; riken structural g | 99.49 | |
| 3gvx_A | 290 | Glycerate dehydrogenase related protein; NYSGXRC, | 99.49 | |
| 1qp8_A | 303 | Formate dehydrogenase; oxidoreductase; HET: NDP; 2 | 99.47 | |
| 1xdw_A | 331 | NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas | 99.47 | |
| 3d64_A | 494 | Adenosylhomocysteinase; structural genomics, ssgci | 99.45 | |
| 1v8b_A | 479 | Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 | 99.45 | |
| 2cuk_A | 311 | Glycerate dehydrogenase/glyoxylate reductase; stru | 99.45 | |
| 1dxy_A | 333 | D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc | 99.44 | |
| 2g76_A | 335 | 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor | 99.43 | |
| 1mx3_A | 347 | CTBP1, C-terminal binding protein 1; nuclear prote | 99.4 | |
| 1gdh_A | 320 | D-glycerate dehydrogenase; oxidoreductase(CHOH (D) | 99.4 | |
| 2ekl_A | 313 | D-3-phosphoglycerate dehydrogenase; structural gen | 99.36 | |
| 3ba1_A | 333 | HPPR, hydroxyphenylpyruvate reductase; two domain | 99.32 | |
| 3oet_A | 381 | Erythronate-4-phosphate dehydrogenase; structural | 99.3 | |
| 2gcg_A | 330 | Glyoxylate reductase/hydroxypyruvate reductase; NA | 99.26 | |
| 2w2k_A | 348 | D-mandelate dehydrogenase; 2-hydroxyacid dehydroge | 99.22 | |
| 2o4c_A | 380 | Erythronate-4-phosphate dehydrogenase; erythronate | 99.21 | |
| 2d0i_A | 333 | Dehydrogenase; structural genomics, NPPSFA, nation | 99.21 | |
| 2dbq_A | 334 | Glyoxylate reductase; D-3-phosphoglycerate dehydro | 99.18 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 99.06 | |
| 3n58_A | 464 | Adenosylhomocysteinase; ssgcid, hydrolase, structu | 98.7 | |
| 3h9u_A | 436 | Adenosylhomocysteinase; NAD CO-factor complex, str | 98.63 | |
| 1gtm_A | 419 | Glutamate dehydrogenase; oxidoreductase, NAD, NADP | 98.54 | |
| 3gvp_A | 435 | Adenosylhomocysteinase 3; protein CO-factor comple | 98.39 | |
| 2rir_A | 300 | Dipicolinate synthase, A chain; structural genomic | 98.36 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 98.33 | |
| 3ce6_A | 494 | Adenosylhomocysteinase; protein-substrate complex, | 98.32 | |
| 1v8b_A | 479 | Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 | 98.09 | |
| 3d64_A | 494 | Adenosylhomocysteinase; structural genomics, ssgci | 98.05 | |
| 2vhw_A | 377 | Alanine dehydrogenase; NAD, secreted, oxidoreducta | 97.98 | |
| 1gtm_A | 419 | Glutamate dehydrogenase; oxidoreductase, NAD, NADP | 97.35 | |
| 1c1d_A | 355 | L-phenylalanine dehydrogenase; amino acid dehydrog | 97.28 | |
| 2eez_A | 369 | Alanine dehydrogenase; TTHA0216, structural genomi | 97.17 | |
| 1x13_A | 401 | NAD(P) transhydrogenase subunit alpha; NAD(H)-bind | 97.11 | |
| 4dio_A | 405 | NAD(P) transhydrogenase subunit alpha PART 1; stru | 97.07 | |
| 3l6d_A | 306 | Putative oxidoreductase; structural genomics, prot | 97.0 | |
| 3qha_A | 296 | Putative oxidoreductase; seattle structural genomi | 96.99 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 96.98 | |
| 3p2y_A | 381 | Alanine dehydrogenase/pyridine nucleotide transhy; | 96.89 | |
| 3pdu_A | 287 | 3-hydroxyisobutyrate dehydrogenase family protein; | 96.74 | |
| 4gbj_A | 297 | 6-phosphogluconate dehydrogenase NAD-binding; stru | 96.55 | |
| 1l7d_A | 384 | Nicotinamide nucleotide transhydrogenase, subunit | 96.53 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 96.48 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 96.27 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 96.09 | |
| 3pef_A | 287 | 6-phosphogluconate dehydrogenase, NAD-binding; gam | 96.04 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 95.91 | |
| 3qsg_A | 312 | NAD-binding phosphogluconate dehydrogenase-like P; | 95.9 | |
| 2zyd_A | 480 | 6-phosphogluconate dehydrogenase, decarboxylating; | 95.79 | |
| 1vpd_A | 299 | Tartronate semialdehyde reductase; structural geno | 95.77 | |
| 1yb4_A | 295 | Tartronic semialdehyde reductase; structural genom | 95.75 | |
| 3obb_A | 300 | Probable 3-hydroxyisobutyrate dehydrogenase; struc | 95.46 | |
| 3cky_A | 301 | 2-hydroxymethyl glutarate dehydrogenase; rossmann | 95.35 | |
| 2yjz_A | 201 | Metalloreductase steap4; oxidoreductase, metabolic | 94.31 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 95.21 | |
| 4gwg_A | 484 | 6-phosphogluconate dehydrogenase, decarboxylating; | 95.13 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 95.04 | |
| 2iz1_A | 474 | 6-phosphogluconate dehydrogenase, decarboxylating; | 94.82 | |
| 1gpj_A | 404 | Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro | 94.73 | |
| 3ond_A | 488 | Adenosylhomocysteinase; plant protein, enzyme-subs | 94.72 | |
| 2cvz_A | 289 | Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; | 94.29 | |
| 2p4q_A | 497 | 6-phosphogluconate dehydrogenase, decarboxylating; | 94.24 | |
| 2gf2_A | 296 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct | 94.04 | |
| 1pgj_A | 478 | 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o | 93.8 | |
| 2pv7_A | 298 | T-protein [includes: chorismate mutase (EC 5.4.99 | 93.58 | |
| 2g5c_A | 281 | Prephenate dehydrogenase; TYRA, oxidoreductase; HE | 92.75 | |
| 2uyy_A | 316 | N-PAC protein; long-chain dehydrogenase, cytokine; | 92.53 | |
| 2q3e_A | 467 | UDP-glucose 6-dehydrogenase; hexamer, structural g | 92.34 | |
| 1np3_A | 338 | Ketol-acid reductoisomerase; A DEEP figure-OF-eigh | 90.58 | |
| 4e12_A | 283 | Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 | 90.2 | |
| 1leh_A | 364 | Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi | 89.75 | |
| 2pgd_A | 482 | 6-phosphogluconate dehydrogenase; oxidoreductase ( | 89.57 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 87.5 | |
| 4a7p_A | 446 | UDP-glucose dehydrogenase; oxidoreductase, carbohy | 86.68 | |
| 3b1f_A | 290 | Putative prephenate dehydrogenase; enzyme, 4-hydro | 85.92 | |
| 2vhw_A | 377 | Alanine dehydrogenase; NAD, secreted, oxidoreducta | 85.59 | |
| 1gpj_A | 404 | Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro | 85.06 | |
| 2raf_A | 209 | Putative dinucleotide-binding oxidoreductase; NP_7 | 84.88 | |
| 3ce6_A | 494 | Adenosylhomocysteinase; protein-substrate complex, | 84.75 | |
| 3ktd_A | 341 | Prephenate dehydrogenase; structural genomics, joi | 84.75 | |
| 1i36_A | 264 | Conserved hypothetical protein MTH1747; NADP bindi | 83.62 | |
| 2d5c_A | 263 | AROE, shikimate 5-dehydrogenase; substrate, dimer, | 83.55 | |
| 3c24_A | 286 | Putative oxidoreductase; YP_511008.1, structural g | 83.53 | |
| 3d1l_A | 266 | Putative NADP oxidoreductase BF3122; structural ge | 82.35 | |
| 2i99_A | 312 | MU-crystallin homolog; thyroid hormine binding pro | 80.21 | |
| 2qrj_A | 394 | Saccharopine dehydrogenase, NAD+, L-lysine- formin | 80.04 |
| >3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} | Back alignment and structure |
|---|
Probab=99.96 E-value=1.1e-30 Score=220.67 Aligned_cols=129 Identities=27% Similarity=0.312 Sum_probs=111.9
Q ss_pred cCCcccc-----ceeeeEEEeccccccCCc-cceeeccCHHHHhccCCEEEEccCCCCCCcceeCHhHHhccCCCcEEEe
Q psy5266 11 TGTPGQV-----HLIVCVLIRYHVDLTGGS-KQVYLILVIRTRSAQSDFIFVTCALTKDTEQLIGRKQFSLMKPTAILIN 84 (180)
Q Consensus 11 ~G~iG~~-----~~~~~~~~~~~~~~~~~~-~~~~~~~~l~~l~~~~D~v~~h~pl~~~T~glIg~~~i~~mk~g~~lvn 84 (180)
.|+||+. +.|||++++||+...... +....+.+|+|++++||||++|+|+|++|+||||++.|++||+|+++||
T Consensus 149 ~G~IG~~va~~~~~fg~~v~~~d~~~~~~~~~~~~~~~~l~ell~~sDivslh~Plt~~T~~li~~~~l~~mk~~a~lIN 228 (334)
T 3kb6_A 149 TGRIGSRVAMYGLAFGMKVLCYDVVKREDLKEKGCVYTSLDELLKESDVISLHVPYTKETHHMINEERISLMKDGVYLIN 228 (334)
T ss_dssp CSHHHHHHHHHHHHTTCEEEEECSSCCHHHHHTTCEECCHHHHHHHCSEEEECCCCCTTTTTCBCHHHHHHSCTTEEEEE
T ss_pred cchHHHHHHHhhcccCceeeecCCccchhhhhcCceecCHHHHHhhCCEEEEcCCCChhhccCcCHHHHhhcCCCeEEEe
Confidence 6888885 468999999997654322 2234678999999999999999999999999999999999999999999
Q ss_pred cCCCCccCHHHHHHHHhcCCcceEEeecCCCCCCCCCC---------------CCCCCCceeec----ccCHHH
Q psy5266 85 TSRGGLLDQEALVEFLRDKKIGGAGLDVMIPEPLPADH---------------PLVQLDNCGNG----LLDQEA 139 (180)
Q Consensus 85 ~~Rg~~vd~~al~~~L~~~~i~~~~lDv~~~ep~~~~~---------------~l~~~~Nv~~g----~~~~~a 139 (180)
++||++||+++|.++|++|+|.+|+||||++||++.++ +|+++|||+.| ..+.++
T Consensus 229 ~aRG~iVde~aL~~aL~~g~i~gA~LDV~~~EPl~~~~~~~~~~~~~~~~~~~~L~~~~nvilTPHia~~T~ea 302 (334)
T 3kb6_A 229 TARGKVVDTDALYRAYQRGKFSGLGLDVFEDEEILILKKYTEGKATDKNLKILELACKDNVIITPHIAYYTDKS 302 (334)
T ss_dssp CSCGGGBCHHHHHHHHHTTCEEEEEESCCTTHHHHHTTGGGGTCCCHHHHHHHHHHTSTTEEECCSCTTCBHHH
T ss_pred cCccccccHHHHHHHHHhCCceEEEEeCCCCCCCcccccccccccccccccchhhccCCCEEECCchhhChHHH
Confidence 99999999999999999999999999999999975554 67889999996 445554
|
| >3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} | Back alignment and structure |
|---|
| >3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A | Back alignment and structure |
|---|
| >3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} | Back alignment and structure |
|---|
| >3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A | Back alignment and structure |
|---|
| >2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* | Back alignment and structure |
|---|
| >4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} | Back alignment and structure |
|---|
| >1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* | Back alignment and structure |
|---|
| >3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* | Back alignment and structure |
|---|
| >2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A | Back alignment and structure |
|---|
| >2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A | Back alignment and structure |
|---|
| >1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} | Back alignment and structure |
|---|
| >3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* | Back alignment and structure |
|---|
| >1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* | Back alignment and structure |
|---|
| >1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* | Back alignment and structure |
|---|
| >2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B | Back alignment and structure |
|---|
| >2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A | Back alignment and structure |
|---|
| >2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* | Back alignment and structure |
|---|
| >3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} | Back alignment and structure |
|---|
| >3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A | Back alignment and structure |
|---|
| >3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A | Back alignment and structure |
|---|
| >3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} | Back alignment and structure |
|---|
| >4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} | Back alignment and structure |
|---|
| >3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* | Back alignment and structure |
|---|
| >2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A | Back alignment and structure |
|---|
| >3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* | Back alignment and structure |
|---|
| >2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A | Back alignment and structure |
|---|
| >4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* | Back alignment and structure |
|---|
| >1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* | Back alignment and structure |
|---|
| >1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} | Back alignment and structure |
|---|
| >3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* | Back alignment and structure |
|---|
| >1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 | Back alignment and structure |
|---|
| >2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* | Back alignment and structure |
|---|
| >1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* | Back alignment and structure |
|---|
| >3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A | Back alignment and structure |
|---|
| >2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B | Back alignment and structure |
|---|
| >2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* | Back alignment and structure |
|---|
| >3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* | Back alignment and structure |
|---|
| >1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A | Back alignment and structure |
|---|
| >3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* | Back alignment and structure |
|---|
| >1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 | Back alignment and structure |
|---|
| >3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* | Back alignment and structure |
|---|
| >2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* | Back alignment and structure |
|---|
| >1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A | Back alignment and structure |
|---|
| >1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* | Back alignment and structure |
|---|
| >4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* | Back alignment and structure |
|---|
| >1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* | Back alignment and structure |
|---|
| >3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} | Back alignment and structure |
|---|
| >2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* | Back alignment and structure |
|---|
| >1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 | Back alignment and structure |
|---|
| >3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* | Back alignment and structure |
|---|
| >2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* | Back alignment and structure |
|---|
| >2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* | Back alignment and structure |
|---|
| >1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A | Back alignment and structure |
|---|
| >1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 | Back alignment and structure |
|---|
| >4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* | Back alignment and structure |
|---|
| >1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 | Back alignment and structure |
|---|
| >2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} | Back alignment and structure |
|---|
| >3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A | Back alignment and structure |
|---|
| >2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* | Back alignment and structure |
|---|
| >1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 | Back alignment and structure |
|---|
| >2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* | Back alignment and structure |
|---|
| >3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 | Back alignment and structure |
|---|
| >2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* | Back alignment and structure |
|---|
| >3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} | Back alignment and structure |
|---|
| >3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 180 | ||||
| d1sc6a1 | 188 | c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase | 4e-21 | |
| d2naca1 | 188 | c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudom | 6e-21 | |
| d1ygya1 | 184 | c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase | 4e-17 | |
| d1gdha1 | 191 | c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyp | 3e-16 | |
| d1mx3a1 | 193 | c.2.1.4 (A:126-318) Transcription corepressor CtbP | 8e-16 | |
| d1mx3a1 | 193 | c.2.1.4 (A:126-318) Transcription corepressor CtbP | 4e-09 | |
| d1dxya1 | 199 | c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydro | 2e-06 | |
| d1qp8a1 | 181 | c.2.1.4 (A:83-263) Putative formate dehydrogenase | 2e-06 | |
| d1qp8a1 | 181 | c.2.1.4 (A:83-263) Putative formate dehydrogenase | 5e-06 | |
| d1j4aa1 | 197 | c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lacto | 3e-06 |
| >d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 188 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Formate/glycerate dehydrogenases, NAD-domain domain: Phosphoglycerate dehydrogenase species: Escherichia coli [TaxId: 562]
Score = 83.5 bits (205), Expect = 4e-21
Identities = 32/86 (37%), Positives = 46/86 (53%), Gaps = 4/86 (4%)
Query: 49 AQSDFIFVTCALTKDTEQLIGRKQFSLMKPTAILINTSRGGLLDQEALVEFLRDKKIGGA 108
SD + + T+ ++G K+ SLMKP ++LIN SRG ++D AL + L K + GA
Sbjct: 95 NMSDVVSLHVPENPSTKNMMGAKEISLMKPGSLLINASRGTVVDIPALADALASKHLAGA 154
Query: 109 GLDVMIPEPL----PADHPLVQLDNC 130
+DV EP P PL + DN
Sbjct: 155 AIDVFPTEPATNSDPFTSPLAEFDNV 180
|
| >d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Length = 188 | Back information, alignment and structure |
|---|
| >d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 184 | Back information, alignment and structure |
|---|
| >d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Length = 191 | Back information, alignment and structure |
|---|
| >d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Length = 193 | Back information, alignment and structure |
|---|
| >d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Length = 193 | Back information, alignment and structure |
|---|
| >d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Length = 199 | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 181 | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 181 | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Length = 197 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 180 | |||
| d1ygya1 | 184 | Phosphoglycerate dehydrogenase {Mycobacterium tube | 99.97 | |
| d1sc6a1 | 188 | Phosphoglycerate dehydrogenase {Escherichia coli [ | 99.96 | |
| d1mx3a1 | 193 | Transcription corepressor CtbP {Human (Homo sapien | 99.96 | |
| d1gdha1 | 191 | D-glycerate dehydrogenase {Hyphomicrobium methylov | 99.96 | |
| d2naca1 | 188 | Formate dehydrogenase {Pseudomonas sp., strain 101 | 99.96 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 99.96 | |
| d1dxya1 | 199 | D-2-hydroxyisocaproate dehydrogenase {Lactobacillu | 99.95 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 99.95 | |
| d1ygya1 | 184 | Phosphoglycerate dehydrogenase {Mycobacterium tube | 99.76 | |
| d1gdha1 | 191 | D-glycerate dehydrogenase {Hyphomicrobium methylov | 99.74 | |
| d1mx3a1 | 193 | Transcription corepressor CtbP {Human (Homo sapien | 99.74 | |
| d2naca1 | 188 | Formate dehydrogenase {Pseudomonas sp., strain 101 | 99.73 | |
| d1dxya1 | 199 | D-2-hydroxyisocaproate dehydrogenase {Lactobacillu | 99.65 | |
| d1sc6a1 | 188 | Phosphoglycerate dehydrogenase {Escherichia coli [ | 99.65 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 99.63 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 99.33 | |
| d1li4a1 | 163 | S-adenosylhomocystein hydrolase {Human (Homo sapie | 98.46 | |
| d1v8ba1 | 163 | S-adenosylhomocystein hydrolase {Plasmodium falcip | 97.04 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 96.84 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 95.91 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 95.86 | |
| d2b0ja2 | 242 | 5,10-methenyltetrahydromethanopterin hydrogenase, | 95.08 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 93.75 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 92.6 | |
| d1l7da1 | 183 | Nicotinamide nucleotide transhydrogenase dI compon | 91.93 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 89.2 | |
| d1c1da1 | 201 | Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ | 85.23 | |
| d1l7da2 | 194 | Nicotinamide nucleotide transhydrogenase dI compon | 83.98 | |
| d2cvza2 | 156 | Hydroxyisobutyrate dehydrogenase {Thermus thermoph | 83.06 |
| >d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Formate/glycerate dehydrogenases, NAD-domain domain: Phosphoglycerate dehydrogenase species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=99.97 E-value=4.6e-32 Score=209.87 Aligned_cols=124 Identities=29% Similarity=0.437 Sum_probs=110.6
Q ss_pred cCCcccc-----ceeeeEEEeccccccCCc--cceeeccCHHHHhccCCEEEEccCCCCCCcceeCHhHHhccCCCcEEE
Q psy5266 11 TGTPGQV-----HLIVCVLIRYHVDLTGGS--KQVYLILVIRTRSAQSDFIFVTCALTKDTEQLIGRKQFSLMKPTAILI 83 (180)
Q Consensus 11 ~G~iG~~-----~~~~~~~~~~~~~~~~~~--~~~~~~~~l~~l~~~~D~v~~h~pl~~~T~glIg~~~i~~mk~g~~lv 83 (180)
.|+||+. ..|||++++||+...... +......+++|++++||+|++|+|+|++|++|||.+.|++||+++++|
T Consensus 52 ~G~IG~~va~~~~~fg~~v~~~d~~~~~~~~~~~~~~~~~l~ell~~sDiv~~~~Plt~~T~~lin~~~l~~mk~~a~lI 131 (184)
T d1ygya1 52 LGRIGQLVAQRIAAFGAYVVAYDPYVSPARAAQLGIELLSLDDLLARADFISVHLPKTPETAGLIDKEALAKTKPGVIIV 131 (184)
T ss_dssp CSHHHHHHHHHHHTTTCEEEEECTTSCHHHHHHHTCEECCHHHHHHHCSEEEECCCCSTTTTTCBCHHHHTTSCTTEEEE
T ss_pred ccchhHHHHHHhhhccceEEeecCCCChhHHhhcCceeccHHHHHhhCCEEEEcCCCCchhhhhhhHHHHhhhCCCceEE
Confidence 6788884 468999999988765311 222467899999999999999999999999999999999999999999
Q ss_pred ecCCCCccCHHHHHHHHhcCCcceEEeecCCCCCCCCCCCCCCCCceeeccc
Q psy5266 84 NTSRGGLLDQEALVEFLRDKKIGGAGLDVMIPEPLPADHPLVQLDNCGNGLL 135 (180)
Q Consensus 84 n~~Rg~~vd~~al~~~L~~~~i~~~~lDv~~~ep~~~~~~l~~~~Nv~~g~~ 135 (180)
|++||++||+++|.++|+++++.+|+||||++||++ ++||+++|||+.+++
T Consensus 132 N~sRG~iVde~aL~~aL~~~~i~~a~lDV~~~EP~~-~~~l~~~~nviiTPH 182 (184)
T d1ygya1 132 NAARGGLVDEAALADAITGGHVRAAGLDVFATEPCT-DSPLFELAQVVVTPH 182 (184)
T ss_dssp ECSCTTSBCHHHHHHHHHTSSEEEEEESSCSSSSCS-CCGGGGCTTEEECSS
T ss_pred EecchhhhhhHHHHHHHhcCcEeEEEEeCCCCCCCC-CchHhcCCCEEECCC
Confidence 999999999999999999999999999999999975 899999999998754
|
| >d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} | Back information, alignment and structure |
|---|
| >d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} | Back information, alignment and structure |
|---|
| >d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1l7da2 c.23.12.2 (A:1-143,A:327-377) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|