Diaphorina citri psyllid: psy5279

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310

MGDCIGRDEGLYSVIARNIASTISHSVTVHVEDNENEYSYRTYARGRQVKTRTKPITDAYDFGDELGRGVTGIVYHAVERSSGRNYAAKVMTGKGTISHSVTVHVEDNENEYSYRTYARGRQVKTRTKPITDAYDFGDELGRGVTGTISHSVTVHVEDNENEYSYRTYARGRQVKTRTKPITDAYDFGDELGRGVTGIVYHAVERSSGRNYAAKVMTGKGNQYKSLFKNELDIMNQLCHRNLVRLHDSYETKDSFTIISELAGGGELLHSLTRQSYYTEYDIAHYIRQLLSGLDYMHRLSIAHLGLTPGDLLVAHPGGRHLLLTDFGLSRRITSFGKLNPLEYDVRYVRQALRHPWLNFADRKPTEDTPKLNTDALRNYYNLYKDWYGNAAVRRYYRRRPLNSCYTHPSRMIYPPGTQFTPEPTPDKVLVSRDLRDVKTWEDNVPNRGPDVKTWEDNVPNRGPGGELLHSLTRQSYYTEYDIAHYIRQLLSGLDYMHRLSIAHLGLTPGDLLVAHPGGRHLLLTDFGLSRRITSFGKLNPLEYGNGQYKVAVTPAMKHLQAITEAGHTPTLAQDPPPLNYSVEDSPIEWSTEPPTDKYQFISEIHRGKFSVVVKAAEKANTENLVAAKLFEYSHDTLHQVNTEFDNLRSLRHERIASLLEAYKPSTTASNIAVLVMEKLQGADVLSYLSSRHEYTEQNVATIISQAWEHYLKKNREQIADTADKSRIPRTIREYREQSANTANLRDVKTWEDNVPNRGPAIDYDLNVVKSESHYQNGPDTYLLQLRDVDFPVRLREYIKVASTRPDLRLSTGFNCLDTSENGHLDWKAPVIRERRRFTDVMDEEIDDERRNRINKYGAADTYTLRRLRHEIGTRPEAHVEADALIESRRDGHAPFFREKPITIPVVIGDKLEMKCLAVGEPKPVIQWFKLGTSTLCYLPIVIPTTHKDAYCVTSVLDGLQYLHWRGLCHLNIEPDNVVMASVRSVQVKLIDLGCTQRVTKLGTLIHPINTPNPEFAAPEVLAEEPIFPQTDVWSAGVLAYVLLSGASPFRGQSEPETRQNVNFVRYRFEYLFKELTQEATRFLMLIFKHEVDWITLANNIDHEFWHVKDLKRETNYTFRLSAKNVIGWSEKGIPSALFKTKEQAPEVLAEEPIFPQTDVWSAGVLAYVLLSGASPFRGQSEPETRQNVNFVRYRFEYLFKELTQEATRFLMLIFKRAPGKRPTVEECHENRWLVPSEYMIKKRERAVFLGNRLKEFSDEYHDLKNKQFTSDSLSSLHKTLTRSNSIQEELISTAFTSHLVNKPSSDSSTL

ccccccccccEEEEEEEcccccEEEEEEEEEEcccccccccccccccccccccccccccccccccccccEEEEEEEEEEEcccccccEEEEcccccEEccEEEEEccccccCEEEEcccccccccccccccccccccccccccccccccccEEECccccccccccccccccccCEEccccccccEEccccccccccEEEEEEEEcccccEEEEEEEcccccccHHHHHHHHHHHHHcccccccCEEHHHcccccEEEEEEcccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccEEcccccccEEECccccccEEEEEccccccccccccccccccccEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccCCcccccccCECcccccccCEEECccccccccccccCEECccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccHHHHHccccHHHHHHHHcccccccHHHHHHHHHHHHHccccccccHHHccccccccccEEEEEEEEccccccHHHHcccccccHHHHHHHHHHHHHHHHcccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccHHHHHHHcccccccccccccccccccccccccccccHHHHHccccccccHHHHHHHHHHHHcccccccEEEEEEEcccccccccHHHHHHHHHHHcccccccccccccccccccccccEEEEEEECccccEEEEECccccccccccHcccccHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEcccccEEEEEccccEEECcccEEEEccccccccccccHHcccccccccccccHHHHHHHHHcccccccccccHHHHHHcccEEEEEccccHHHHcHHHHHHHHHHHcccccccHHHHHHccccccccccccccccHHHHcHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccHHHHHHHHccccccccHHHHHHcHHHHHHHHHHHcccccccccHHHHHcccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccccccccccccccccccccc

****IGRDEGLYSVIARNIASTISHSVTVHVEDNENEYSYRTYARGRQVKTRTKPITDAYDFGDELGRGVTGIVYHAVERSSGRNYAAKVMTGKGTISHSVTVHVEDNENEYSYRTYARGRQVKTR**********************************NEYSYRTYARGRQVKTRTKPITDAYDFGDELGRGVTGIVYHAVERSSGRNYAAKVMTGKGNQYKSLFKNELDIMNQLCHRNLVRLHDSYETKDSFTIISELAGGGELLHSLTRQSYYTEYDIAHYIRQLLSGLDYMHRLSIAHLGLTPGDLLVAHPGGRHLLLTDFGLSRRITSFGKLNPLEYDVRYVRQALRHPWLNFADRKPTEDTPKLNTDALRNYYNLYKDWYGNAAVRRYYRRRPLNSCYTHPSRMIYPPGTQFTPEPTP***********VKTWEDNVPNRGPDVKTWEDNVPNRGPGGELLHSLTRQSYYTEYDIAHYIRQLLSGLDYMHRLSIAHLGLTPGDLLVAHPGGRHLLLTDFGLSRRITSFGKLNPLEYGNGQYKVAVTPAMKHLQAITEAGHTPTLAQDPPPLNYSVEDSPIEWSTEPPTDKYQFISEIHRGKFSVVVKAAEKANTENLVAAKLFEYSHDTLHQVNTEFDNLRSLRHERIASLLEAYKPSTTASNIAVLVMEKLQGADVLSYLSSRHEYTEQNVATIISQAWEHYLKKNREQIADTADKSRIPRTIREYREQSANTANLRDVKTWEDNVPNRGPAIDYDLNVVKSESHYQNGPDTYLLQLRDVDFPVRLREYIKVASTRPDLRLSTGFNCLDTSENGHLDWKAPVIRERRRFTDVMDEEIDD***NRINKYGAADTYTLRRLRHEIGTRPEAHVEADALIESRRDGHAPFFREKPITIPVVIGDKLEMKCLAVGEPKPVIQWFKLGTSTLCYLPIVIPTTHKDAYCVTSVLDGLQYLHWRGLCHLNIEPDNVVMASVRSVQVKLIDLGCTQRVTKLGTLIHPINTPNPEFAAPEVLAEEPIFPQTDVWSAGVLAYVLLSGASPFRGQSEPETRQNVNFVRYRFEYLFKELTQEATRFLMLIFKHEVDWITLANNIDHEFWHVKDLKRETNYTFRLSAKNVIGWSEKGIPSALFKTKEQAPEVLAEEPIFPQTDVWSAGVLAYVLLSGASPFRGQSEPETRQNVNFVRYRFEYLFKELTQEATRFLMLIFKRAPGKRPTVEECHENRWLVPSEYMIKKRERAVFLGNRLKEFSDEYHD************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005524 [MF]	ATP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0044093 [BP]	positive regulation of molecular function	probable	GO:0008150, GO:0065009, GO:0065007
GO:0046777 [BP]	protein autophosphorylation	probable	GO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0080090 [BP]	regulation of primary metabolic process	probable	GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0060255 [BP]	regulation of macromolecule metabolic process	probable	GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0004683 [MF]	calmodulin-dependent protein kinase activity	probable	GO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0007243 [BP]	intracellular protein kinase cascade	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0031323 [BP]	regulation of cellular metabolic process	probable	GO:0008150, GO:0065007, GO:0050789, GO:0019222, GO:0050794

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UTO, chain A
Confidence level:very confident
Coverage over the Query: 51-412
View the alignment between query and template
View the model in PyMOL

Template: 1KOB, chain A
Confidence level:very confident
Coverage over the Query: 586-697,947-1053
View the alignment between query and template
View the model in PyMOL

Template: 3I6U, chain A
Confidence level:very confident
Coverage over the Query: 180-333,345-359,378-411,426-491
View the alignment between query and template
View the model in PyMOL

Template: 1PHK, chain A
Confidence level:very confident
Coverage over the Query: 950-1025,1101,1148-1237
View the alignment between query and template
View the model in PyMOL

Template: 2WQM, chain A
Confidence level:very confident
Coverage over the Query: 948-992,1012-1101
View the alignment between query and template
View the model in PyMOL

Template: 3G51, chain A
Confidence level:confident
Coverage over the Query: 191-329
View the alignment between query and template
View the model in PyMOL

Template: 3UJG, chain A
Confidence level:probable
Coverage over the Query: 184-330
View the alignment between query and template
View the model in PyMOL

Template: 4FG9, chain A
Confidence level:probable
Coverage over the Query: 177-326
View the alignment between query and template
View the model in PyMOL

Template: 2YA9, chain A
Confidence level:probable
Coverage over the Query: 177-332
View the alignment between query and template
View the model in PyMOL

Template: 3MTR, chain A
Confidence level:probable
Coverage over the Query: 889-974,987-1013,1025-1142
View the alignment between query and template
View the model in PyMOL

Template: 3B43, chain A
Confidence level:probable
Coverage over the Query: 842-931
View the alignment between query and template
View the model in PyMOL