Psyllid ID: psy5279


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310
MGDCIGRDEGLYSVIARNIASTISHSVTVHVEDNENEYSYRTYARGRQVKTRTKPITDAYDFGDELGRGVTGIVYHAVERSSGRNYAAKVMTGKGTISHSVTVHVEDNENEYSYRTYARGRQVKTRTKPITDAYDFGDELGRGVTGTISHSVTVHVEDNENEYSYRTYARGRQVKTRTKPITDAYDFGDELGRGVTGIVYHAVERSSGRNYAAKVMTGKGNQYKSLFKNELDIMNQLCHRNLVRLHDSYETKDSFTIISELAGGGELLHSLTRQSYYTEYDIAHYIRQLLSGLDYMHRLSIAHLGLTPGDLLVAHPGGRHLLLTDFGLSRRITSFGKLNPLEYDVRYVRQALRHPWLNFADRKPTEDTPKLNTDALRNYYNLYKDWYGNAAVRRYYRRRPLNSCYTHPSRMIYPPGTQFTPEPTPDKVLVSRDLRDVKTWEDNVPNRGPDVKTWEDNVPNRGPGGELLHSLTRQSYYTEYDIAHYIRQLLSGLDYMHRLSIAHLGLTPGDLLVAHPGGRHLLLTDFGLSRRITSFGKLNPLEYGNGQYKVAVTPAMKHLQAITEAGHTPTLAQDPPPLNYSVEDSPIEWSTEPPTDKYQFISEIHRGKFSVVVKAAEKANTENLVAAKLFEYSHDTLHQVNTEFDNLRSLRHERIASLLEAYKPSTTASNIAVLVMEKLQGADVLSYLSSRHEYTEQNVATIISQAWEHYLKKNREQIADTADKSRIPRTIREYREQSANTANLRDVKTWEDNVPNRGPAIDYDLNVVKSESHYQNGPDTYLLQLRDVDFPVRLREYIKVASTRPDLRLSTGFNCLDTSENGHLDWKAPVIRERRRFTDVMDEEIDDERRNRINKYGAADTYTLRRLRHEIGTRPEAHVEADALIESRRDGHAPFFREKPITIPVVIGDKLEMKCLAVGEPKPVIQWFKLGTSTLCYLPIVIPTTHKDAYCVTSVLDGLQYLHWRGLCHLNIEPDNVVMASVRSVQVKLIDLGCTQRVTKLGTLIHPINTPNPEFAAPEVLAEEPIFPQTDVWSAGVLAYVLLSGASPFRGQSEPETRQNVNFVRYRFEYLFKELTQEATRFLMLIFKHEVDWITLANNIDHEFWHVKDLKRETNYTFRLSAKNVIGWSEKGIPSALFKTKEQAPEVLAEEPIFPQTDVWSAGVLAYVLLSGASPFRGQSEPETRQNVNFVRYRFEYLFKELTQEATRFLMLIFKRAPGKRPTVEECHENRWLVPSEYMIKKRERAVFLGNRLKEFSDEYHDLKNKQFTSDSLSSLHKTLTRSNSIQEELISTAFTSHLVNKPSSDSSTL
ccccccccccEEEEEEEcccccEEEEEEEEEEcccccccccccccccccccccccccccccccccccccEEEEEEEEEEEcccccccEEEEcccccEEccEEEEEccccccEEEEEcccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccEEEccccccccEEccccccccccEEEEEEEEcccccEEEEEEEcccccccHHHHHHHHHHHHHcccccccEEEHHHcccccEEEEEEcccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccEEcccccccEEEEccccccEEEEEccccccccccccccccccccEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccEEcccccccEEEcccccccEEEEEccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccHHHHHccccHHHHHHHHcccccccHHHHHHHHHHHHHccccccccHHHHcccccccccEEEEEEEEccccccHHHHcccccccHHHHHHHHHHHHHHHHcccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccHHHHHHHcccccccccccccccccccccccccccccHHHHHcccccccHHHHHHHHHHHHHcccccccEEEEEEEccccccccHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEEEccccEEEEEEccccccccccHHccccHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEcccccEEEEEccccEEEEcccEEEEccccccccccccHHcccccccccccccHHHHHHHHHcccccccccccHHHHHHcccEEEEEccccHHHHcHHHHHHHHHHHcccccccHHHHHHcccccccccccccccHHHHHcHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccHHHHHHHHccccccccHHHHHHcHHHHHHHHHHHcccccccccHHHHHHcccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccccccccccccccccccccccc
cccccEccccEEEEEEEEccccEEEEEEEEEEEcccccccEEcccccEEEEccccccccccccHHcccccEEEEEcccccccccEEEEEEEccccEEEEcEEEEEcccccccEEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccHHHcEEEEEEEEEEccEEEEEEEEcccccEEEEEEEEcccHHHHHHHHHHHHHHcccccccEccEEEEEEcccEEEEEEEcccccEHHHHccccccccHHHHHHHHHHHHHHHHHHHHccEEEccccHHHEEEcccccccEEEEEccccEEEccccEEEEEcccHHHcccccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHcccccccccHHHHHcccHHHcccHHHcccccccccccccccccHHHHHHHHHccccccEEccccccccccccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccEcccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccEEccccccccccHHHHccccccEEEEEEEEccccccEEEEEEEcccccHHHHHHHHHHHHHHcccccHEcHHHcccccccccHHHEEEEHHccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccHccccccccccccccccccEEccccEEEccccccccccEEEEEEcccccccEEHEHEEHHccccccEEccccccccccccccccEEEHEEEHHHHHccccccccccHHccccccccccccccHHHHHHHcccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccEEEEEEEccccEEEEEEcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccEEEccccHHHHEEcccccccEEEEEccccEEcccccEEEEEEEcccHHHccHHHHcccEEcHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHccHHHcccHHHHHccccccccccccHcccccccccccccccccccEEEEccccccccHHHHccccEcHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHccccccccHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHccccHHccccHHHHHcccccccccccccccccccc
mgdcigrdegLYSVIARNIASTISHSVtvhvedneneysyrtyargrqvktrtkpitdaydfgdelgrgVTGIVYHAVERSSGRNYAAKVMtgkgtishSVTVhvedneneysyrtyargrqvktrtkpitdaydfgdelgrgvtgtiSHSVTvhvedneneysyrtyargrqvktrtkpitdaydfgdelgrgVTGIVYHAVERSSGRNYAAKVMtgkgnqyksLFKNELDIMNQLCHRNLVrlhdsyetkdSFTIISELAgggellhsltrqsyytEYDIAHYIRQLLSGLDYMHRLSIahlgltpgdllvahpggrhllltdfglsrritsfgklnpleyDVRYVRQAlrhpwlnfadrkptedtpklntDALRNYYNLYKDWYGNAAVRRYyrrrplnscythpsrmiyppgtqftpeptpdkvlvsrdlrdvktwednvpnrgpdvktwednvpnrgpggellhsltrqsyyteYDIAHYIRQLLSGLDYMHRLSIahlgltpgdllvahpggrhllltdfglsrritsfgklnpleygngqykvAVTPAMKHLQAITeaghtptlaqdppplnysvedspiewstepptdkyqfisEIHRGKFSVVVKAAEKANTENLVAAKLFEYSHDTLHQVNTEFDNLRSLRHERIASLLEaykpsttasNIAVLVMEKLQGADVLSYLSSRHEYTEQNVATIISQAWEHYLKKNREQIAdtadksriprTIREYREQsantanlrdvktwednvpnrgpaidydlnvvkseshyqngpdtyllqlrdvdFPVRLREYIKVastrpdlrlstgfncldtsenghldwkapviRERRrftdvmdeeiDDERRNRINKYGAADTYTLRRLRHeigtrpeahVEADALIEsrrdghapffrekpitipvvigdklemkclavgepkpviqwfklgtstlcylpiviptthkdaycVTSVLDGLQYLHWRglchlniepdnVVMASVRSVQVKLIDLGCTQRVtklgtlihpintpnpefaapevlaeepifpqtdvwSAGVLAYVLLsgaspfrgqsepetrqnvNFVRYRFEYLFKELTQEATRFLMLIFKHEVDWITlannidhefwhvkdlkretnyTFRLSAKnvigwsekgipsalfktkeqapevlaeepifpqtdvwSAGVLAYVLLsgaspfrgqsepetrqnvNFVRYRFEYLFKELTQEATRFLMLIFkrapgkrptveechenrwlvpseyMIKKRERAVFLGNRLKEFSDEYHDlknkqftsDSLSSLHKTLTRSNSIQEELISTAFTShlvnkpssdsstl
mgdcigrdEGLYSVIARNiastishsvtvhvedneneysyrtyargrqvktrtkpitdaydfgdelgrGVTGIVYHAVERSSGRNYAAKVMTgkgtishsvtvhvedneneysyrtyargrqvktrtkpitdaydfgdelgrgvtgtishsvtvhvedneneysyrtyargrqvktrtkpitdaydfgdelgrGVTGIVYHAVERSSGRNYAAKVMTGKGNQYKSLFKNELDIMNQLCHRNLVRLHDSYETKDSFTIISELAGGGELLHSLTRQSYYTEYDIAHYIRQLLSGLDYMHRLSIAHLGLTPGDLLVAHPGGRHLLLTDFGLSRRITsfgklnpleYDVRYVRQALRhpwlnfadrkptedtpklntdALRNYYNLYKDWYGNAAVRRYYRRRPLNSCYTHPSRMIYPPGTQFTPEPTPDKVLVSRDlrdvktwednvpnrgpdvktwednvpnrgpggeLLHSLTRQSYYTEYDIAHYIRQLLSGLDYMHRLSIAHLGLTPGDLLVAHPGGRHLLLTDFGLSRRITSFgklnpleygNGQYKVAVTPAMKHLQAITEAGHTPTLAQDPPPLNYSVEDSPIEWSTEPPTDKYQFISEIHRGKFSVVVKAAEKANTENLVAAKLFEYSHDTLHQVNTEFDNLRSLRHERIASLLEAYKPSTTASNIAVLVMEKLQGADVLSYLSSRHEYTEQNVATIISQAWEHYLKKNReqiadtadksriprtireyreqsantanlrdvktwednvpnrgpaidYDLNVVKSEShyqngpdtyllqLRDVDFPVRLREYIkvastrpdlrlstgfncldtsenghldwkapvirerrrftdvmdeeidderrnrinkygaadtytlrrlrheigtrpeahVEADALIESrrdghapffrekpitipvVIGDKLEMKCLAVGEPKPVIQWFKLGTSTLCYLPIVIPTTHKDAYCVTSVLDGLQYLHWRGLCHLNIEPDNVVMASVRSVQVKLIDLGCTQRVTKLGTLIHPINTPNPEFAAPEVLAEEPIFPQTDVWSAGVLAYVLLSGaspfrgqsepetrqnvnFVRYRFEYLFKELTQEATRFLMLIFKHEVDWITLANNIDHEFWHVKDLKRETNYTFRLSAKNVIGWSEKGIPSALFKTKEQAPEVLAEEPIFPQTDVWSAGVLAYVLLSGaspfrgqsepetrqnvnFVRYRFEYLFKELTQEATRFLMLIFKrapgkrptveechenrwlvpseymikKRERAVFLGNRLKEFSDEYHDLKNKQFTSDSLSSLHKTLTRSNSIQEELISTaftshlvnkpssdsstl
MGDCIGRDEGLYSVIARNIASTISHSVTVHVEDNENEYSYRTYARGRQVKTRTKPITDAYDFGDELGRGVTGIVYHAVERSSGRNYAAKVMTGKGTISHSVTVHVEDNENEYSYRTYARGRQVKTRTKPITDAYDFGDELGRGVTGTISHSVTVHVEDNENEYSYRTYARGRQVKTRTKPITDAYDFGDELGRGVTGIVYHAVERSSGRNYAAKVMTGKGNQYKSLFKNELDIMNQLCHRNLVRLHDSYETKDSFTIISELAGGGELLHSLTRQSYYTEYDIAHYIRQLLSGLDYMHRLSIAHLGLTPGDLLVAHPGGRHLLLTDFGLSRRITSFGKLNPLEYDVRYVRQALRHPWLNFADRKPTEDTPKLNTDALRNYYNLYKDWYGNAAVRRYYRRRPLNSCYTHPSRMIYPPGTQFTPEPTPDKVLVSRDLRDVKTWEDNVPNRGPDVKTWEDNVPNRGPGGELLHSLTRQSYYTEYDIAHYIRQLLSGLDYMHRLSIAHLGLTPGDLLVAHPGGRHLLLTDFGLSRRITSFGKLNPLEYGNGQYKVAVTPAMKHLQAITEAGHTPTLAQDPPPLNYSVEDSPIEWSTEPPTDKYQFISEIHRGKFSVVVKAAEKANTENLVAAKLFEYSHDTLHQVNTEFDNLRSLRHERIASLLEAYKPSTTASNIAVLVMEKLQGADVLSYLSSRHEYTEQNVATIISQAWEHYLKKNREQIADTADKSRIPRTIREYREQSANTANLRDVKTWEDNVPNRGPAIDYDLNVVKSESHYQNGPDTYLLQLRDVDFPVRLREYIKVASTRPDLRLSTGFNCLDTSENGHLDWKAPVIRERRRFTDVMDEEIDDERRNRINKYGAADTYTLRRLRHEIGTRPEAHVEADALIESRRDGHAPFFREKPITIPVVIGDKLEMKCLAVGEPKPVIQWFKLGTSTLCYLPIVIPTTHKDAYCVTSVLDGLQYLHWRGLCHLNIEPDNVVMASVRSVQVKLIDLGCTQRVTKLGTLIHPINTPNPEFAAPEVLAEEPIFPQTDVWSAGVLAYVLLSGASPFRGQSEPETRQNVNFVRYRFEYLFKELTQEATRFLMLIFKHEVDWITLANNIDHEFWHVKDLKRETNYTFRLSAKNVIGWSEKGIPSALFKTKEQAPEVLAEEPIFPQTDVWSAGVLAYVLLSGASPFRGQSEPETRQNVNFVRYRFEYLFKELTQEATRFLMLIFKRAPGKRPTVEECHENRWLVPSEYMIKKRERAVFLGNRLKEFSDEYHDLKNKQFTSDSLSSLHKTLTRSNSIQEELISTAFTSHLVNKPSSDSSTL
****IGRDEGLYSVIARNIASTISHSVTVHVEDNENEYSYRTYARGRQVKTRTKPITDAYDFGDELGRGVTGIVYHAVERSSGRNYAAKVMTGKGTISHSVTVHVEDNENEYSYRTYARGRQVKTRTKPITDAYDFGDELGRGVTGTISHSVTVHVEDNENEYSYRTYARGRQVKTRTKPITDAYDFGDELGRGVTGIVYHAVERSSGRNYAAKVMTGKGNQYKSLFKNELDIMNQLCHRNLVRLHDSYETKDSFTIISELAGGGELLHSLTRQSYYTEYDIAHYIRQLLSGLDYMHRLSIAHLGLTPGDLLVAHPGGRHLLLTDFGLSRRITSFGKLNPLEYDVRYVRQALRHPWLNFADR*******KLNTDALRNYYNLYKDWYGNAAVRRYYRRRPLNSCYTHPSRMIYP**********************V*TW*************************ELLHSLTRQSYYTEYDIAHYIRQLLSGLDYMHRLSIAHLGLTPGDLLVAHPGGRHLLLTDFGLSRRITSFGKLNPLEYGNGQYKVAVTPAMKHLQAIT*********************************KYQFISEIHRGKFSVVVKAAEKANTENLVAAKLFEYSHDTLHQVNTEFDNLRSLRHERIASLLEAYKPSTTASNIAVLVMEKLQGADVLSYLSSRHEYTEQNVATIISQAWEHYLKKN********************************VKTWEDNVPNRGPAIDYDLNVVKSESHYQNGPDTYLLQLRDVDFPVRLREYIKVASTRPDLRLSTGFNCLDTSENGHLDWKAPVIRERRRFTDVMD********NRINKYGAADTYTLRRLRHEIGTRPEAHVEADALIESRRDGHAPFFREKPITIPVVIGDKLEMKCLAVGEPKPVIQWFKLGTSTLCYLPIVIPTTHKDAYCVTSVLDGLQYLHWRGLCHLNIEPDNVVMASVRSVQVKLIDLGCTQRVTKLGTLIHPINTPNPEFAAPEVLAEEPIFPQTDVWSAGVLAYVLLSGA*************NVNFVRYRFEYLFKELTQEATRFLMLIFKHEVDWITLANNIDHEFWHVKDLKRETNYTFRLSAKNVIGWSEKGIPSALFKTKEQAPEVLAEEPIFPQTDVWSAGVLAYVLLSGA*************NVNFVRYRFEYLFKELTQEATRFLMLIFKRAPGKRPTVEECHENRWLVPSEYMIKKRERAVFLGNRLKEFSDEY**************************************************
****IGRDEGLYSVIARNIASTISHSVTVHVEDNENE**********************YDFGDELGRGVTGIVYHAVERSSGRNYAAKVMTGKGTISHSVTVHVEDNENEYSY*T*************************************************************TKPITDAYDFGDELGRGVTGIVYHAVERSSGRNYAAKVMTGKGN*YKSLFKNELDIMNQLCHRNLVRLHDSYETKDSFTIISELAGGGELLHSLTRQSYYTEYDIAHYIRQLLSGLDYMHRLSIAHLGLTPGDLLVAHPGGRHLLLTDFGLSRRITSFGKLNPLEYDVRYVRQALRHPWLNFADRKPTEDTPKLNTDALRNYYNLYKDWYGNAAVRRYYRRRPLNSCYTHPSRMIYPPGTQFTPEPTP***********VKTWEDNVPNRGPDVKTWEDNVPNRGPGGELLHSLTRQSYYTEYDIAHYIRQLLSGLDYMHRLSIAHLGLTPGDLLVAHPGGRHLLLTDFGLSRRITSFGKLNPLEYGNGQYKVAVTPAMKHLQAITEAGHTPTLAQDPPPLNYSVEDSPIEWSTEPPTDKYQFISEIHRGKFSVVVKAAEKANTENLVAAKLFEYSHDTLHQVNTEFDNLRSLRHERIASLLEAYKPSTTASNIAVLVMEKLQGADVLSYLSSRHEYTEQNVATIISQAWEHYLKKNREQIADTADKSRIPRTIREYREQSANTANLRDVK******PNRGPAIDYDLNVVKSESHYQNGPDTYLLQLRDVDFPVRLREYIK*******************SENGHLDWKAPVIRERRRFTDVMDEEIDD********************RHEIGTRPEAHVEADALIESRRDG***FFREKPITIPVVIGDKLEMKCLAVGEPKPVIQWFKLGTSTLCYLPIVIPTTHKDAYCVTSVLDGLQYLHWRGLCHLNIEPDNVVMASVRSVQVKLIDLGCTQRVTKLGTLIHPINTPNPEFAAPEVLAEEPIFPQTDVWSAGVLAYVLLSGASPFRGQSEPETRQNVNFVRYRFEYLFKELTQEATRFLMLIFKHEVDWITLANNIDHEFWHVKDLKRE**YTFRLSAKNVIGWSEKGIPSALFKTKEQAPEVLAEEPIFPQTDVWSAGVLAYVLLSGASPFRGQSEPETRQNVNFVRYRFEYLFKELTQEATRFLMLIFKRAPGKRPTVEECHENRWLVP*****************LKEFSDEYHD************************************************
MGDCIGRDEGLYSVIARNIASTISHSVTVHVEDNENEYSYRTYARGRQVKTRTKPITDAYDFGDELGRGVTGIVYHAVERSSGRNYAAKVMTGKGTISHSVTVHVEDNENEYSYRTYARGRQVKTRTKPITDAYDFGDELGRGVTGTISHSVTVHVEDNENEYSYRTYARGRQVKTRTKPITDAYDFGDELGRGVTGIVYHAVERSSGRNYAAKVMTGKGNQYKSLFKNELDIMNQLCHRNLVRLHDSYETKDSFTIISELAGGGELLHSLTRQSYYTEYDIAHYIRQLLSGLDYMHRLSIAHLGLTPGDLLVAHPGGRHLLLTDFGLSRRITSFGKLNPLEYDVRYVRQALRHPWLNFADRKPTEDTPKLNTDALRNYYNLYKDWYGNAAVRRYYRRRPLNSCYTHPSRMIYPPGTQFTPEPTPDKVLVSRDLRDVKTWEDNVPNRGPDVKTWEDNVPNRGPGGELLHSLTRQSYYTEYDIAHYIRQLLSGLDYMHRLSIAHLGLTPGDLLVAHPGGRHLLLTDFGLSRRITSFGKLNPLEYGNGQYKVAVTPAMKHLQAITEAGHTPTLAQDPPPLNYSVEDSPIEWSTEPPTDKYQFISEIHRGKFSVVVKAAEKANTENLVAAKLFEYSHDTLHQVNTEFDNLRSLRHERIASLLEAYKPSTTASNIAVLVMEKLQGADVLSYLSSRHEYTEQNVATIISQAWEHYLKKNREQIADTADKSRIPRTIREYREQSANTANLRDVKTWEDNVPNRGPAIDYDLNVVKSESHYQNGPDTYLLQLRDVDFPVRLREYIKVASTRPDLRLSTGFNCLDTSENGHLDWKAPVIRERRRFTDVMDEEIDDERRNRINKYGAADTYTLRRLRHEIGTRPEAHVEADALIESRRDGHAPFFREKPITIPVVIGDKLEMKCLAVGEPKPVIQWFKLGTSTLCYLPIVIPTTHKDAYCVTSVLDGLQYLHWRGLCHLNIEPDNVVMASVRSVQVKLIDLGCTQRVTKLGTLIHPINTPNPEFAAPEVLAEEPIFPQTDVWSAGVLAYVLLSGASPFRGQSEPETRQNVNFVRYRFEYLFKELTQEATRFLMLIFKHEVDWITLANNIDHEFWHVKDLKRETNYTFRLSAKNVIGWSEKGIPSALFKTKEQAPEVLAEEPIFPQTDVWSAGVLAYVLLSGASPFRGQSEPETRQNVNFVRYRFEYLFKELTQEATRFLMLIFKRAPGKRPTVEECHENRWLVPSEYMIKKRERAVFLGNRLKEFSDEYHDLKNKQFTSDSLSSLHKTLTRSNSIQEELISTAFTSH************
*GDCIGRDEGLYSVIARNIASTISHSVTVHVEDNENEYSYRTYARGRQVKTRTKPITDAYDFGDELGRGVTGIVYHAVERSSGRNYAAKVMTGKGTISHSVTVHVEDNENEYSYRTYARGRQVKTR**********************************NEYSYRTYARGRQVKTRTKPITDAYDFGDELGRGVTGIVYHAVERSSGRNYAAKVMTGKGNQYKSLFKNELDIMNQLCHRNLVRLHDSYETKDSFTIISELAGGGELLHSLTRQSYYTEYDIAHYIRQLLSGLDYMHRLSIAHLGLTPGDLLVAHPGGRHLLLTDFGLSRRITSFGKLNPLEYDVRYVRQALRHPWLNFADRKPTEDTPKLNTDALRNYYNLYKDWYGNAAVRRYYRRRPLNSCYTHPSRMIYPPGTQFTPEPTPDKVLVSRDLRDVKTWEDNVPNRGPDVKTWEDNVPNRGPGGELLHSLTRQSYYTEYDIAHYIRQLLSGLDYMHRLSIAH***TPGDLLVAHPGGRHLLLTD**LS********LNPLEYGNGQYKVAVTPAMKHLQAITEAGHTPTLAQDP***NYS***SPIEWSTEPPTDKYQFISEIHRGKFSVVVKAAEKANTENLVAAKLFEYSHDTLHQVNTEFDNLRSLRHERIASLLEAYKPSTTASNIAVLVMEKLQGADVLSYLSSRHEYTEQNVATIISQAWEHYLKKNREQIADTADKSRIPRTIREYREQSANTANLRDVKTWEDNVPNRGPAIDYDLNVVKSESHYQNGPDTYLLQLRDVDFPVRLREYIKVASTRPDLRLSTGFNCLDTSENGHLDWKAPVIRERRRFTDVMDEEIDDERRNRINKYGAADTYTLRRLRHEIGTRPEAHVEADALIESRRDGHAPFFREKPITIPVVIGDKLEMKCLAVGEPKPVIQWFKLGTSTLCYLPIVIPTTHKDAYCVTSVLDGLQYLHWRGLCHLNIEPDNVVMASVRSVQVKLIDLGCTQRVTKLGTLIHPINTPNPEFAAPEVLAEEPIFPQTDVWSAGVLAYVLLSGASPFRGQSEPETRQNVNFVRYRFEYLFKELTQEATRFLMLIFKHEVDWITLANNIDHEFWHVKDLKRETNYTFRLSAKNVIGWSEKGIPSALFKTKEQAPEVLAEEPIFPQTDVWSAGVLAYVLLSGASPFRGQSEPETRQNVNFVRYRFEYLFKELTQEATRFLMLIFKRAPGKRPTVEECHENRWLVPSEYMIKKRERAVFLGNRLKEFSDEYHDLKNKQFTSDSLSSLHKTLTRSNSIQEELIST*****************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDCIGRDEGLYSVIARNIASTISHSVTVHVEDNENEYSYRTYARGRQVKTRTKPITDAYDFGDELGRGVTGIVYHAVERSSGRNYAAKVMTGKGTISHSVTVHVEDNENEYSYRTYARGRQVKTRTKPITDAYDFGDELGRGVTGTISHSVTVHVEDNENEYSYRTYARGRQVKTRTKPITDAYDFGDELGRGVTGIVYHAVERSSGRNYAAKVMTGKGNQYKSLFKNELDIMNQLCHRNLVRLHDSYETKDSFTIISELAGGGELLHSLTRQSYYTEYDIAHYIRQLLSGLDYMHRLSIAHLGLTPGDLLVAHPGGRHLLLTDFGLSRRITSFGKLNPLEYDVRYVRQALRHPWLNFADRKPTEDTPKLNTDALRNYYNLYKDWYGNAAVRRYYRRRPLNSCYTHPSRMIYPPGTQFTPEPTPDKVLVSRDLRDVKTWEDNVPNRGPDVKTWEDNVPNRGPGGELLHSLTRQSYYTEYDIAHYIRQLLSGLDYMHRLSIAHLGLTPGDLLVAHPGGRHLLLTDFGLSRRITSFGKLNPLEYGNGQYKVAVTPAMKHLQAITEAGHTPTLAQDPPPLNYSVEDSPIEWSTEPPTDKYQFISEIHRGKFSVVVKAAEKANTENLVAAKLFEYSHDTLHQVNTEFDNLRSLRHERIASLLEAYKPSTTASNIAVLVMEKLQGADVLSYLSSRHEYTEQNVATIISQAWEHYLKKNREQIADTADKSRIPRTIREYREQSANTANLRDVKTWEDNVPNRGPAIDYDLNVVKSESHYQNGPDTYLLQLRDVDFPVRLREYIKVASTRPDLRLSTGFNCLDTSENGHLDWKAPVIRERRRFTDVMDEEIDDERRNRINKYGAADTYTLRRLRHEIGTRPEAHVEADALIESRRDGHAPFFREKPITIPVVIGDKLEMKCLAVGEPKPVIQWFKLGTSTLCYLPIVIPTTHKDAYCVTSVLDGLQYLHWRGLCHLNIEPDNVVMASVRSVQVKLIDLGCTQRVTKLGTLIHPINTPNPEFAAPEVLAEEPIFPQTDVWSAGVLAYVLLSGASPFRGQSEPETRQNVNFVRYRFEYLFKELTQEATRFLMLIFKHEVDWITLANNIDHEFWHVKDLKRETNYTFRLSAKNVIGWSEKGIPSALFKTKEQAPEVLAEEPIFPQTDVWSAGVLAYVLLSGASPFRGQSEPETRQNVNFVRYRFEYLFKELTQEATRFLMLIFKRAPGKRPTVEECHENRWLVPSEYMIKKRERAVFLGNRLKEFSDEYHDLKNKQFTSDSLSSLHKTLTRSNSIQEELISTAFTSHLVNKPSSDSSTL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1310 2.2.26 [Sep-21-2011]
E9PT87786 Myosin light chain kinase yes N/A 0.107 0.179 0.422 1e-25
Q3UIZ8795 Myosin light chain kinase yes N/A 0.107 0.177 0.422 3e-25
P117991906 Myosin light chain kinase no N/A 0.137 0.094 0.333 4e-25
Q6PDN31941 Myosin light chain kinase no N/A 0.137 0.092 0.333 1e-24
A8C984715 Myosin light chain kinase no N/A 0.122 0.223 0.368 3e-24
Q288241176 Myosin light chain kinase no N/A 0.137 0.153 0.327 3e-24
P292941147 Myosin light chain kinase yes N/A 0.137 0.156 0.333 3e-24
Q32MK0819 Myosin light chain kinase no N/A 0.128 0.205 0.368 4e-24
Q5RDG7819 Myosin light chain kinase yes N/A 0.128 0.205 0.368 4e-24
Q157461914 Myosin light chain kinase no N/A 0.137 0.094 0.322 3e-23
>sp|E9PT87|MYLK3_RAT Myosin light chain kinase 3 OS=Rattus norvegicus GN=Mylk3 PE=1 SV=1 Back     alignment and function desciption
 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 90/142 (63%), Gaps = 1/142 (0%)

Query: 191 LGRGVTGIVYHAVERSSGRNYAAKVMTGKGNQYKSLFKNELDIMNQLCHRNLVRLHDSYE 250
           LG G  G V+   ERS+G   AAK++  K  + +   KNE++IMNQL H NL++L+D++E
Sbjct: 488 LGGGRFGQVHRCTERSTGLALAAKIIKVKNIKDREDVKNEINIMNQLSHVNLIQLYDAFE 547

Query: 251 TKDSFTIISELAGGGELLHSLTRQSYY-TEYDIAHYIRQLLSGLDYMHRLSIAHLGLTPG 309
           +K+SFT+I E   GGEL   +T + Y+ TE D+  + RQ+  G+ Y+H+  I HL L P 
Sbjct: 548 SKNSFTLIMEYVDGGELFDRITDEKYHLTELDVVLFTRQICEGVHYLHQHYILHLDLKPE 607

Query: 310 DLLVAHPGGRHLLLTDFGLSRR 331
           ++L     G  + + DFGL+RR
Sbjct: 608 NILCVSQTGHQIKIIDFGLARR 629




Calmodulin-dependent kinase that phosphorylates MYL2 in vitro. Promotes sarcomere formation in cardiomyocytes. Increases cardiomyocyte contractility.
Rattus norvegicus (taxid: 10116)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1EC: 8
>sp|Q3UIZ8|MYLK3_MOUSE Myosin light chain kinase 3 OS=Mus musculus GN=Mylk3 PE=1 SV=1 Back     alignment and function description
>sp|P11799|MYLK_CHICK Myosin light chain kinase, smooth muscle OS=Gallus gallus PE=1 SV=2 Back     alignment and function description
>sp|Q6PDN3|MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus GN=Mylk PE=1 SV=3 Back     alignment and function description
>sp|A8C984|MYLK3_DANRE Myosin light chain kinase 3 OS=Danio rerio GN=mylk3 PE=2 SV=1 Back     alignment and function description
>sp|Q28824|MYLK_BOVIN Myosin light chain kinase, smooth muscle OS=Bos taurus GN=MYLK PE=1 SV=1 Back     alignment and function description
>sp|P29294|MYLK_RABIT Myosin light chain kinase, smooth muscle OS=Oryctolagus cuniculus GN=MYLK PE=1 SV=2 Back     alignment and function description
>sp|Q32MK0|MYLK3_HUMAN Myosin light chain kinase 3 OS=Homo sapiens GN=MYLK3 PE=2 SV=3 Back     alignment and function description
>sp|Q5RDG7|MYLK3_PONAB Myosin light chain kinase 3 OS=Pongo abelii GN=MYLK3 PE=2 SV=3 Back     alignment and function description
>sp|Q15746|MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens GN=MYLK PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1310
340713883 5692 PREDICTED: hypothetical protein LOC10064 0.249 0.057 0.422 8e-74
350418885 5683 PREDICTED: hypothetical protein LOC10074 0.249 0.057 0.420 4e-73
332020158 5681 Muscle M-line assembly protein unc-89 [A 0.135 0.031 0.637 3e-64
322795623542 hypothetical protein SINV_01871 [Solenop 0.283 0.686 0.385 8e-64
195430902 4238 GK21935 [Drosophila willistoni] gi|19415 0.241 0.074 0.394 1e-61
307168125 5829 Muscle M-line assembly protein unc-89 [C 0.135 0.030 0.610 1e-61
307213781 4410 Muscle M-line assembly protein unc-89 [H 0.133 0.039 0.620 2e-61
328781653 5651 PREDICTED: hypothetical protein LOC40883 0.153 0.035 0.598 7e-61
321472492 3812 hypothetical protein DAPPUDRAFT_315830 [ 0.154 0.053 0.562 3e-60
383849519 5668 PREDICTED: uncharacterized protein LOC10 0.133 0.030 0.606 5e-60
>gi|340713883|ref|XP_003395464.1| PREDICTED: hypothetical protein LOC100649328 [Bombus terrestris] Back     alignment and taxonomy information
 Score =  285 bits (730), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 167/395 (42%), Positives = 227/395 (57%), Gaps = 68/395 (17%)

Query: 747  VKTWEDNVPNRGPAIDYDLNVVKSESHYQNGPDTYLLQLRDVDFPVRLREYIKVASTRPD 806
             K WE+ +  R P ID ++ ++KSESHYQNGPDTYLLQLRD DFPVRLREY+KVA  R  
Sbjct: 4989 AKPWENQIATREP-IDTEIGIIKSESHYQNGPDTYLLQLRDTDFPVRLREYMKVACNR-- 5045

Query: 807  LRLSTGFNCLDTSENGHLDWKAPVIRERRRFTDVMDEEIDDERRNRINKYGAADTYTLRR 866
               S GF+   T E+   DW+ P+IRERRRFTD+MDEEIDDERR RI++YGA D +TLRR
Sbjct: 5046 ---SPGFSRTITEES--FDWRTPIIRERRRFTDIMDEEIDDERRARISRYGA-DNFTLRR 5099

Query: 867  LRHEIGTRPEAHVEADALIESRRDGHAPFFREKPITIPVVIGDKLEMKCLAVGEPKPVIQ 926
            L+HE+GTR +++ EA+A+IES+++GH PFFREKP   P+  G   ++ CLAVG PKPVIQ
Sbjct: 5100 LKHELGTRLDSYAEAEAMIESKKEGHLPFFREKPQIKPMEEGMPAQLACLAVGSPKPVIQ 5159

Query: 927  WFKLGTSTLCYLPIVIPTTHKDAYCVTSVLDGLQYLHWRGLCHLNIEPDNVVMASVRSVQ 986
            W+K          ++I  +++    VT   DG   L +      +I    +V  +     
Sbjct: 5160 WYKND--------MMIQESNR--VKVTEDQDGRSILSFNPTKEHDIGSYKIVARN----- 5204

Query: 987  VKLIDLGCTQRVTKLGTLIHPINTPNPEFAAPEVLAEEPIFPQTDVWSAGVLAYVLLSGA 1046
                 LG T   T+L   + P+   +PE               +DV    +L        
Sbjct: 5205 ----SLGQTVVRTRLVEAVVPLGPDSPEL--------------SDVSDTEILLR------ 5240

Query: 1047 SPFRGQSEPETRQNVNFVRYRFEYLFKELTQEATRFLMLIFKHEVDWITLANNIDHEFWH 1106
                   +P+   N   + Y  +Y   +                VDWI +A+NIDHEF+ 
Sbjct: 5241 -----WKQPKYDGNSPVLCYNLQYKLGD---------------SVDWIDIASNIDHEFYM 5280

Query: 1107 VKDLKRETNYTFRLSAKNVIGWSEKGIPSALFKTK 1141
            ++DL  +T+Y FRL+A+N +GWSEKGIPS L KT+
Sbjct: 5281 IRDLTPDTSYNFRLAARNRVGWSEKGIPSKLIKTR 5315




Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350418885|ref|XP_003492000.1| PREDICTED: hypothetical protein LOC100744578 [Bombus impatiens] Back     alignment and taxonomy information
>gi|332020158|gb|EGI60602.1| Muscle M-line assembly protein unc-89 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322795623|gb|EFZ18302.1| hypothetical protein SINV_01871 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|195430902|ref|XP_002063487.1| GK21935 [Drosophila willistoni] gi|194159572|gb|EDW74473.1| GK21935 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|307168125|gb|EFN61404.1| Muscle M-line assembly protein unc-89 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307213781|gb|EFN89117.1| Muscle M-line assembly protein unc-89 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328781653|ref|XP_392361.4| PREDICTED: hypothetical protein LOC408830 isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|321472492|gb|EFX83462.1| hypothetical protein DAPPUDRAFT_315830 [Daphnia pulex] Back     alignment and taxonomy information
>gi|383849519|ref|XP_003700392.1| PREDICTED: uncharacterized protein LOC100881888 [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1310
FB|FBgn00535194218 Unc-89 "Unc-89" [Drosophila me 0.165 0.051 0.490 2.6e-171
ZFIN|ZDB-GENE-030131-3230 2995 speg "SPEG complex locus" [Dan 0.101 0.044 0.338 6.9e-35
RGD|21243259 Speg "SPEG complex locus" [Rat 0.129 0.052 0.347 3e-42
UNIPROTKB|G3N0223281 SPEG "Uncharacterized protein" 0.112 0.045 0.350 6.1e-36
MGI|MGI:1092823262 Speg "SPEG complex locus" [Mus 0.129 0.052 0.342 4.3e-41
UNIPROTKB|E2R2D83274 SPEG "Uncharacterized protein" 0.129 0.051 0.336 1.2e-39
UNIPROTKB|F6X4X43272 SPEG "Uncharacterized protein" 0.129 0.051 0.336 1.6e-39
UNIPROTKB|Q157723267 SPEG "Striated muscle preferen 0.129 0.052 0.331 2e-39
FB|FBgn00056668933 bt "bent" [Drosophila melanoga 0.153 0.022 0.328 7.3e-38
ZFIN|ZDB-GENE-040812-4 2009 obscn "obscurin, cytoskeletal 0.123 0.080 0.292 7.3e-37
FB|FBgn0053519 Unc-89 "Unc-89" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 539 (194.8 bits), Expect = 2.6e-171, Sum P(6) = 2.6e-171
 Identities = 109/222 (49%), Positives = 153/222 (68%)

Query:   142 RGVTGTISHSVTVHVEDNENEYSYRTYARGRQVKTRTKPITDAYDFGDELGRGVTGIVYH 201
             R + G+IS SVTVH+E+NE++Y Y+TY R   V+++     D YD GDELGRG  GI YH
Sbjct:  3143 RNIAGSISTSVTVHIEENEDQYIYKTYGRHPYVRSKQLRYQDKYDIGDELGRGTQGITYH 3202

Query:   202 AVERSSGRNYAAKVMTGKGNQYKSLFKNELDIMNQLCHRNLVRLHDSYETKDSFTIISEL 261
             AVERSSG NYAAK+M G+  + +    NEL++MN   H+NL+R +D+Y+T  S T+I EL
Sbjct:  3203 AVERSSGDNYAAKIMYGRP-ELRPFMLNELEMMNTFNHKNLIRPYDAYDTDRSVTLIMEL 3261

Query:   262 AGGGELLH-SLTRQSYYTEYDIAHYIRQLLSGLDYMHRLSIAHLGLTPGDLLVAHPGGRH 320
             A GGEL+  +L R+ YYTE DIAHYIRQ L GL++MH + + H+GLT  DLL++  GG  
Sbjct:  3262 AAGGELVRDNLLRRDYYTERDIAHYIRQTLWGLEHMHEMGVGHMGLTIKDLLISVVGGDI 3321

Query:   321 LLLTDFGLSRRITSFGKLNPLEYDV-RYVR-QALRHPWLNFA 360
             + ++DFGLSR+I     L+ L+Y +  +V  + +    +NF+
Sbjct:  3322 IKVSDFGLSRKINRHN-LSTLDYGMPEFVSPEVVNKEGVNFS 3362


GO:0005524 "ATP binding" evidence=IEA
GO:0005089 "Rho guanyl-nucleotide exchange factor activity" evidence=IEA
GO:0035023 "regulation of Rho protein signal transduction" evidence=IEA
GO:0006468 "protein phosphorylation" evidence=IKR
GO:0004672 "protein kinase activity" evidence=IKR
GO:0045214 "sarcomere organization" evidence=IMP
GO:0007527 "adult somatic muscle development" evidence=IMP
GO:0031430 "M band" evidence=IDA
ZFIN|ZDB-GENE-030131-3230 speg "SPEG complex locus" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|2124 Speg "SPEG complex locus" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3N022 SPEG "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:109282 Speg "SPEG complex locus" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2R2D8 SPEG "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6X4X4 SPEG "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q15772 SPEG "Striated muscle preferentially expressed protein kinase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0005666 bt "bent" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040812-4 obscn "obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.11.1LOW CONFIDENCE prediction!
3rd Layer2.7.11LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1310
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 2e-39
pfam00069260 pfam00069, Pkinase, Protein kinase domain 6e-31
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 7e-29
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 1e-23
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 2e-22
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 4e-22
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 2e-21
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 2e-21
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 6e-21
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 8e-20
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 9e-19
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 7e-18
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 6e-16
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 7e-16
pfam00069260 pfam00069, Pkinase, Protein kinase domain 1e-15
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 1e-15
PLN00034353 PLN00034, PLN00034, mitogen-activated protein kina 1e-15
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 1e-15
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 1e-15
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 2e-15
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 3e-15
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 9e-15
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 9e-15
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 1e-14
cd05575323 cd05575, STKc_SGK, Catalytic domain of the Protein 1e-14
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 1e-14
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 2e-14
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 2e-14
cd05574316 cd05574, STKc_phototropin_like, Catalytic domain o 4e-14
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 5e-14
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 5e-14
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 6e-14
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 2e-13
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 2e-13
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 2e-13
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 3e-13
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 4e-13
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 4e-13
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 5e-13
cd05604325 cd05604, STKc_SGK3, Catalytic domain of the Protei 7e-13
cd05602325 cd05602, STKc_SGK1, Catalytic domain of the Protei 9e-13
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 9e-13
cd06656297 cd06656, STKc_PAK3, Catalytic domain of the Protei 1e-12
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 1e-12
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 2e-12
cd07870291 cd07870, STKc_PFTAIRE2, Catalytic domain of the Se 2e-12
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 2e-12
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 2e-12
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 4e-12
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 4e-12
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 5e-12
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 5e-12
cd06655296 cd06655, STKc_PAK2, Catalytic domain of the Protei 7e-12
cd06654296 cd06654, STKc_PAK1, Catalytic domain of the Protei 7e-12
cd05603321 cd05603, STKc_SGK2, Catalytic domain of the Protei 8e-12
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 8e-12
cd05571323 cd05571, STKc_PKB, Catalytic domain of the Protein 8e-12
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 9e-12
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 9e-12
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 1e-11
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 1e-11
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 1e-11
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 2e-11
cd05593328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 2e-11
cd05570318 cd05570, STKc_PKC, Catalytic domain of the Protein 2e-11
cd06645267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 5e-11
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 7e-11
cd05619316 cd05619, STKc_nPKC_theta, Catalytic domain of the 8e-11
pfam00069260 pfam00069, Pkinase, Protein kinase domain 9e-11
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 1e-10
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 1e-10
cd06643282 cd06643, STKc_SLK, Catalytic domain of the Protein 1e-10
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 2e-10
cd05595323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 2e-10
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 2e-10
cd05615323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 2e-10
cd07866311 cd07866, STKc_BUR1, Catalytic domain of the Serine 2e-10
cd06646267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 2e-10
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 2e-10
cd07869303 cd07869, STKc_PFTAIRE1, Catalytic domain of the Se 3e-10
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 4e-10
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 4e-10
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 4e-10
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 5e-10
cd05594325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 6e-10
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 6e-10
cd05601330 cd05601, STKc_CRIK, Catalytic domain of the Protei 7e-10
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 9e-10
cd05584323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 9e-10
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 1e-09
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 1e-09
cd05601330 cd05601, STKc_CRIK, Catalytic domain of the Protei 1e-09
cd05586330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 1e-09
cd05589324 cd05589, STKc_PKN, Catalytic domain of the Protein 1e-09
cd05585312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 2e-09
cd05625382 cd05625, STKc_LATS1, Catalytic domain of the Prote 2e-09
cd07864302 cd07864, STKc_CDK12, Catalytic domain of the Serin 2e-09
cd05587324 cd05587, STKc_cPKC, Catalytic domain of the Protei 2e-09
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 3e-09
cd07839284 cd07839, STKc_CDK5, Catalytic domain of the Serine 3e-09
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 3e-09
cd05633279 cd05633, STKc_GRK3, Catalytic domain of the Protei 3e-09
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 4e-09
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 4e-09
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 4e-09
cd05632285 cd05632, STKc_GRK5, Catalytic domain of the Protei 4e-09
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 5e-09
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 5e-09
cd05616323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 5e-09
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 5e-09
cd05610669 cd05610, STKc_MASTL, Catalytic domain of the Prote 5e-09
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 6e-09
PTZ00024335 PTZ00024, PTZ00024, cyclin-dependent protein kinas 6e-09
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 6e-09
cd05630285 cd05630, STKc_GRK6, Catalytic domain of the Protei 6e-09
cd05600333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 8e-09
cd05606278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 9e-09
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 1e-08
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 1e-08
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 1e-08
cd05613290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 1e-08
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 1e-08
cd05620316 cd05620, STKc_nPKC_delta, Catalytic domain of the 1e-08
cd05040257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 1e-08
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 1e-08
cd05590320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 1e-08
cd05623332 cd05623, STKc_MRCK_alpha, Catalytic domain of the 1e-08
cd07845309 cd07845, STKc_CDK10, Catalytic domain of the Serin 2e-08
cd07844291 cd07844, STKc_PCTAIRE_like, Catalytic domain of PC 2e-08
PTZ00263329 PTZ00263, PTZ00263, protein kinase A catalytic sub 2e-08
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 2e-08
cd05626381 cd05626, STKc_LATS2, Catalytic domain of the Prote 2e-08
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 2e-08
cd08222260 cd08222, STKc_Nek11, Catalytic domain of the Prote 2e-08
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 2e-08
pfam00069260 pfam00069, Pkinase, Protein kinase domain 3e-08
pfam00069260 pfam00069, Pkinase, Protein kinase domain 3e-08
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 3e-08
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 4e-08
cd07865310 cd07865, STKc_CDK9, Catalytic domain of the Serine 4e-08
cd05605285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 5e-08
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 6e-08
cd05628363 cd05628, STKc_NDR1, Catalytic domain of the Protei 6e-08
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 7e-08
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 8e-08
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 8e-08
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 8e-08
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 8e-08
cd05627360 cd05627, STKc_NDR2, Catalytic domain of the Protei 8e-08
cd05614332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 9e-08
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 1e-07
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 1e-07
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 1e-07
cd05597331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 1e-07
cd05631285 cd05631, STKc_GRK4, Catalytic domain of the Protei 1e-07
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 2e-07
cd06655296 cd06655, STKc_PAK2, Catalytic domain of the Protei 2e-07
cd05570318 cd05570, STKc_PKC, Catalytic domain of the Protein 2e-07
cd05591321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 2e-07
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 2e-07
cd08229267 cd08229, STKc_Nek7, Catalytic domain of the Protei 2e-07
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 2e-07
cd07855334 cd07855, STKc_ERK5, Catalytic domain of the Serine 2e-07
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 2e-07
cd05624331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 2e-07
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 2e-07
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 3e-07
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 3e-07
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 3e-07
cd05632285 cd05632, STKc_GRK5, Catalytic domain of the Protei 3e-07
cd05618329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 3e-07
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 4e-07
cd07873301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 4e-07
cd05629377 cd05629, STKc_NDR_like_fungal, Catalytic domain of 4e-07
cd06654296 cd06654, STKc_PAK1, Catalytic domain of the Protei 5e-07
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 5e-07
cd07871288 cd07871, STKc_PCTAIRE3, Catalytic domain of the Se 5e-07
cd07854342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 5e-07
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 5e-07
PHA03209357 PHA03209, PHA03209, serine/threonine kinase US3; P 5e-07
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 5e-07
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 6e-07
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 6e-07
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 6e-07
cd05598376 cd05598, STKc_LATS, Catalytic domain of the Protei 6e-07
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 8e-07
cd06656297 cd06656, STKc_PAK3, Catalytic domain of the Protei 8e-07
cd05599364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 8e-07
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 8e-07
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 8e-07
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 9e-07
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 9e-07
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 1e-06
cd05619316 cd05619, STKc_nPKC_theta, Catalytic domain of the 1e-06
cd05600333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 1e-06
cd07872309 cd07872, STKc_PCTAIRE2, Catalytic domain of the Se 1e-06
cd07842316 cd07842, STKc_CDK8_like, Catalytic domain of Cycli 1e-06
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 1e-06
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 2e-06
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 2e-06
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 2e-06
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 2e-06
cd05585312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 2e-06
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 2e-06
cd05588329 cd05588, STKc_aPKC, Catalytic domain of the Protei 2e-06
cd05609305 cd05609, STKc_MAST, Catalytic domain of the Protei 2e-06
cd07857332 cd07857, STKc_MPK1, Catalytic domain of the Serine 2e-06
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 3e-06
cd05602325 cd05602, STKc_SGK1, Catalytic domain of the Protei 3e-06
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 3e-06
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 3e-06
cd05584323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 3e-06
cd05616323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 3e-06
cd06638286 cd06638, STKc_myosinIIIA, Catalytic domain of the 3e-06
cd05622371 cd05622, STKc_ROCK1, Catalytic domain of the Prote 3e-06
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 4e-06
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 4e-06
cd05575323 cd05575, STKc_SGK, Catalytic domain of the Protein 4e-06
cd05574316 cd05574, STKc_phototropin_like, Catalytic domain o 4e-06
cd05596370 cd05596, STKc_ROCK, Catalytic domain of the Protei 4e-06
cd06639291 cd06639, STKc_myosinIIIB, Catalytic domain of the 4e-06
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 5e-06
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 5e-06
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 5e-06
cd05587324 cd05587, STKc_cPKC, Catalytic domain of the Protei 5e-06
cd05610669 cd05610, STKc_MASTL, Catalytic domain of the Prote 5e-06
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 5e-06
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 6e-06
cd07856328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 6e-06
cd05056270 cd05056, PTKc_FAK, Catalytic domain of the Protein 6e-06
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 7e-06
PTZ00036440 PTZ00036, PTZ00036, glycogen synthase kinase; Prov 7e-06
cd06633313 cd06633, STKc_TAO3, Catalytic domain of the Protei 7e-06
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 7e-06
cd05595323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 8e-06
cd05615323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 8e-06
cd05617327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 8e-06
cd05063268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 8e-06
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 8e-06
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 8e-06
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 9e-06
cd05586330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 9e-06
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 1e-05
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 1e-05
cd05570318 cd05570, STKc_PKC, Catalytic domain of the Protein 1e-05
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 1e-05
cd05590320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 1e-05
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 1e-05
cd08229267 cd08229, STKc_Nek7, Catalytic domain of the Protei 1e-05
cd05609305 cd05609, STKc_MAST, Catalytic domain of the Protei 1e-05
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 1e-05
cd07858337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 1e-05
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 1e-05
cd05621370 cd05621, STKc_ROCK2, Catalytic domain of the Prote 1e-05
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 2e-05
cd05604325 cd05604, STKc_SGK3, Catalytic domain of the Protei 2e-05
cd05604325 cd05604, STKc_SGK3, Catalytic domain of the Protei 2e-05
cd05602325 cd05602, STKc_SGK1, Catalytic domain of the Protei 2e-05
cd05603321 cd05603, STKc_SGK2, Catalytic domain of the Protei 2e-05
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 2e-05
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 2e-05
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 2e-05
cd06639291 cd06639, STKc_myosinIIIB, Catalytic domain of the 2e-05
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 2e-05
cd07880343 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of 2e-05
cd05608280 cd05608, STKc_GRK1, Catalytic domain of the Protei 2e-05
cd05630285 cd05630, STKc_GRK6, Catalytic domain of the Protei 3e-05
PTZ00263329 PTZ00263, PTZ00263, protein kinase A catalytic sub 3e-05
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 3e-05
TIGR03903 1266 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas 3e-05
cd07861285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 3e-05
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 4e-05
cd07870291 cd07870, STKc_PFTAIRE2, Catalytic domain of the Se 4e-05
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 4e-05
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 4e-05
cd05618329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 4e-05
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 4e-05
cd05596370 cd05596, STKc_ROCK, Catalytic domain of the Protei 4e-05
cd05621370 cd05621, STKc_ROCK2, Catalytic domain of the Prote 4e-05
TIGR03903 1266 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas 4e-05
PRK13184 932 PRK13184, pknD, serine/threonine-protein kinase; R 4e-05
PLN00009294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 4e-05
cd05613290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 5e-05
cd05590320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 5e-05
cd07863288 cd07863, STKc_CDK4, Catalytic domain of the Serine 5e-05
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 5e-05
cd05045290 cd05045, PTKc_RET, Catalytic domain of the Protein 5e-05
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 6e-05
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 6e-05
cd05589324 cd05589, STKc_PKN, Catalytic domain of the Protein 6e-05
cd05097295 cd05097, PTKc_DDR_like, Catalytic domain of Discoi 6e-05
cd07851343 cd07851, STKc_p38, Catalytic domain of the Serine/ 6e-05
cd05102338 cd05102, PTKc_VEGFR3, Catalytic domain of the Prot 6e-05
cd05615323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 7e-05
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 7e-05
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 8e-05
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 8e-05
cd05589324 cd05589, STKc_PKN, Catalytic domain of the Protein 8e-05
cd05623332 cd05623, STKc_MRCK_alpha, Catalytic domain of the 8e-05
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 8e-05
cd05597331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 8e-05
cd06634308 cd06634, STKc_TAO2, Catalytic domain of the Protei 8e-05
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 8e-05
cd07876359 cd07876, STKc_JNK2, Catalytic domain of the Serine 8e-05
cd06635317 cd06635, STKc_TAO1, Catalytic domain of the Protei 8e-05
cd05588329 cd05588, STKc_aPKC, Catalytic domain of the Protei 9e-05
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 9e-05
cd06607307 cd06607, STKc_TAO, Catalytic domain of the Protein 9e-05
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 1e-04
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 1e-04
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 1e-04
cd05584323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 1e-04
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 1e-04
cd05620316 cd05620, STKc_nPKC_delta, Catalytic domain of the 1e-04
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 1e-04
cd05605285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 1e-04
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 1e-04
cd05591321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 1e-04
cd07855334 cd07855, STKc_ERK5, Catalytic domain of the Serine 1e-04
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 1e-04
cd06638286 cd06638, STKc_myosinIIIA, Catalytic domain of the 1e-04
cd05608280 cd05608, STKc_GRK1, Catalytic domain of the Protei 1e-04
cd07849336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 1e-04
cd07862290 cd07862, STKc_CDK6, Catalytic domain of the Serine 1e-04
cd06619279 cd06619, PKc_MKK5, Catalytic domain of the dual-sp 1e-04
cd05607277 cd05607, STKc_GRK7, Catalytic domain of the Protei 1e-04
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 1e-04
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 1e-04
cd05071262 cd05071, PTKc_Src, Catalytic domain of the Protein 1e-04
PLN00034353 PLN00034, PLN00034, mitogen-activated protein kina 2e-04
cd05574316 cd05574, STKc_phototropin_like, Catalytic domain o 2e-04
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 2e-04
cd05603321 cd05603, STKc_SGK2, Catalytic domain of the Protei 2e-04
cd05593328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 2e-04
cd05631285 cd05631, STKc_GRK4, Catalytic domain of the Protei 2e-04
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 2e-04
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 2e-04
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 2e-04
pfam0767990 pfam07679, I-set, Immunoglobulin I-set domain 2e-04
cd07847286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 2e-04
cd07875364 cd07875, STKc_JNK1, Catalytic domain of the Serine 2e-04
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 2e-04
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 2e-04
PTZ00426340 PTZ00426, PTZ00426, cAMP-dependent protein kinase 2e-04
cd05575323 cd05575, STKc_SGK, Catalytic domain of the Protein 3e-04
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 3e-04
cd05625382 cd05625, STKc_LATS1, Catalytic domain of the Prote 3e-04
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 3e-04
cd07845309 cd07845, STKc_CDK10, Catalytic domain of the Serin 3e-04
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 3e-04
cd05103343 cd05103, PTKc_VEGFR2, Catalytic domain of the Prot 3e-04
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 4e-04
cd05571323 cd05571, STKc_PKB, Catalytic domain of the Protein 4e-04
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 4e-04
cd07844291 cd07844, STKc_PCTAIRE_like, Catalytic domain of PC 4e-04
cd05614332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 4e-04
cd05598376 cd05598, STKc_LATS, Catalytic domain of the Protei 4e-04
cd05045290 cd05045, PTKc_RET, Catalytic domain of the Protein 4e-04
PTZ00267478 PTZ00267, PTZ00267, NIMA-related protein kinase; P 4e-04
cd05576237 cd05576, STKc_RPK118_like, Catalytic domain of the 4e-04
cd07874355 cd07874, STKc_JNK3, Catalytic domain of the Serine 4e-04
cd07879342 cd07879, STKc_p38delta_MAPK13, Catalytic domain of 4e-04
cd05586330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 5e-04
cd05628363 cd05628, STKc_NDR1, Catalytic domain of the Protei 5e-04
cd05617327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 5e-04
cd07863288 cd07863, STKc_CDK4, Catalytic domain of the Serine 5e-04
cd07876359 cd07876, STKc_JNK2, Catalytic domain of the Serine 5e-04
cd08216314 cd08216, PK_STRAD, Pseudokinase domain of STE20-re 5e-04
PHA03212391 PHA03212, PHA03212, serine/threonine kinase US3; P 5e-04
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 6e-04
cd05591321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 6e-04
cd07862290 cd07862, STKc_CDK6, Catalytic domain of the Serine 6e-04
cd07877345 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of 6e-04
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 6e-04
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 6e-04
cd05101304 cd05101, PTKc_FGFR2, Catalytic domain of the Prote 6e-04
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 7e-04
cd07865310 cd07865, STKc_CDK9, Catalytic domain of the Serine 7e-04
cd05629377 cd05629, STKc_NDR_like_fungal, Catalytic domain of 7e-04
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 7e-04
cd08223257 cd08223, STKc_Nek4, Catalytic domain of the Protei 7e-04
cd05057279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 7e-04
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 7e-04
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 7e-04
PHA03207392 PHA03207, PHA03207, serine/threonine kinase US3; P 7e-04
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 8e-04
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 8e-04
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 8e-04
cd07878343 cd07878, STKc_p38beta_MAPK11, Catalytic domain of 8e-04
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 0.001
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 0.001
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 0.001
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 0.001
cd05593328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 0.001
cd05586330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 0.001
cd05587324 cd05587, STKc_cPKC, Catalytic domain of the Protei 0.001
cd05633279 cd05633, STKc_GRK3, Catalytic domain of the Protei 0.001
cd05632285 cd05632, STKc_GRK5, Catalytic domain of the Protei 0.001
cd05606278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 0.001
cd05620316 cd05620, STKc_nPKC_delta, Catalytic domain of the 0.001
cd05627360 cd05627, STKc_NDR2, Catalytic domain of the Protei 0.001
cd07857332 cd07857, STKc_MPK1, Catalytic domain of the Serine 0.001
cd05622371 cd05622, STKc_ROCK1, Catalytic domain of the Prote 0.001
cd07863288 cd07863, STKc_CDK4, Catalytic domain of the Serine 0.001
cd05045290 cd05045, PTKc_RET, Catalytic domain of the Protein 0.001
cd06619279 cd06619, PKc_MKK5, Catalytic domain of the dual-sp 0.001
cd07879342 cd07879, STKc_p38delta_MAPK13, Catalytic domain of 0.001
cd05048283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 0.001
cd06618296 cd06618, PKc_MKK7, Catalytic domain of the dual-sp 0.001
PHA03390267 PHA03390, pk1, serine/threonine-protein kinase 1; 0.001
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 0.001
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 0.001
cd05098307 cd05098, PTKc_FGFR1, Catalytic domain of the Prote 0.001
cd05100334 cd05100, PTKc_FGFR3, Catalytic domain of the Prote 0.001
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 0.002
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 0.002
cd05595323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 0.002
cd07866311 cd07866, STKc_BUR1, Catalytic domain of the Serine 0.002
cd05594325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 0.002
cd05601330 cd05601, STKc_CRIK, Catalytic domain of the Protei 0.002
cd05626381 cd05626, STKc_LATS2, Catalytic domain of the Prote 0.002
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 0.002
cd05631285 cd05631, STKc_GRK4, Catalytic domain of the Protei 0.002
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 0.002
cd07880343 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of 0.002
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 0.002
cd05099314 cd05099, PTKc_FGFR4, Catalytic domain of the Prote 0.002
PHA03211461 PHA03211, PHA03211, serine/threonine kinase US3; P 0.002
cd07848287 cd07848, STKc_CDKL5, Catalytic domain of the Serin 0.002
cd05036277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 0.002
cd05065269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 0.002
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 0.003
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 0.003
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 0.003
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 0.003
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 0.003
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 0.003
cd05606278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 0.003
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 0.003
cd05607277 cd05607, STKc_GRK7, Catalytic domain of the Protei 0.003
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 0.003
PTZ00283 496 PTZ00283, PTZ00283, serine/threonine protein kinas 0.003
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 0.004
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 0.004
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 0.004
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 0.004
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 0.004
cd05571323 cd05571, STKc_PKB, Catalytic domain of the Protein 0.004
cd06646267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 0.004
cd05616323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 0.004
cd05613290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 0.004
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 0.004
cd07873301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 0.004
cd05598376 cd05598, STKc_LATS, Catalytic domain of the Protei 0.004
cd05599364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 0.004
cd06607307 cd06607, STKc_TAO, Catalytic domain of the Protein 0.004
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 0.004
cd05057279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 0.004
PTZ00283496 PTZ00283, PTZ00283, serine/threonine protein kinas 0.004
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 0.004
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
 Score =  147 bits (373), Expect = 2e-39
 Identities = 53/158 (33%), Positives = 88/158 (55%), Gaps = 3/158 (1%)

Query: 185 YDFGDELGRGVTGIVYHAVERSSGRNYAAKVM-TGKGNQYKSLFKNELDIMNQLCHRNLV 243
           Y+  ++LG G  G VY A ++ +G+  A KV+   K  + +     E+ I+ +L H N+V
Sbjct: 1   YEILEKLGEGSFGKVYLARDKKTGKLVAIKVIKKKKIKKDRERILREIKILKKLKHPNIV 60

Query: 244 RLHDSYETKDSFTIISELAGGGELLHSLTRQSYYTEYDIAHYIRQLLSGLDYMHRLSIAH 303
           RL+D +E +D   ++ E   GG+L   L ++   +E +   Y+RQ+LS L+Y+H   I H
Sbjct: 61  RLYDVFEDEDKLYLVMEYCEGGDLFDLLKKRGRLSEDEARFYLRQILSALEYLHSKGIVH 120

Query: 304 LGLTPGDLLVAHPGGRHLLLTDFGLSRRITSFGKLNPL 341
             L P ++L+   G  H+ L DFGL+R++    KL   
Sbjct: 121 RDLKPENILLDEDG--HVKLADFGLARQLDPGEKLTTF 156


Phosphotransferases. Serine or threonine-specific kinase subfamily. Length = 254

>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein Back     alignment and domain information
>gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173667 cd05576, STKc_RPK118_like, Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|165473 PHA03207, PHA03207, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>gnl|CDD|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>gnl|CDD|223009 PHA03211, PHA03211, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1310
KOG0603|consensus612 100.0
KOG0615|consensus475 100.0
KOG0033|consensus355 100.0
KOG0032|consensus382 100.0
KOG0615|consensus475 100.0
KOG0605|consensus550 100.0
KOG0598|consensus357 100.0
KOG0583|consensus370 100.0
KOG0595|consensus429 100.0
KOG0575|consensus592 100.0
KOG0575|consensus 592 100.0
KOG0599|consensus411 100.0
KOG0659|consensus318 100.0
KOG0604|consensus400 100.0
KOG0600|consensus560 100.0
KOG0616|consensus355 100.0
KOG0607|consensus463 100.0
KOG0032|consensus382 100.0
KOG0593|consensus396 100.0
KOG0663|consensus419 100.0
KOG0595|consensus429 100.0
KOG0593|consensus396 100.0
KOG0588|consensus 786 100.0
KOG0661|consensus538 100.0
KOG0583|consensus370 100.0
KOG0605|consensus550 100.0
KOG0592|consensus604 100.0
KOG0694|consensus694 100.0
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 100.0
KOG0597|consensus 808 100.0
KOG0598|consensus357 100.0
KOG0599|consensus411 100.0
cd05610669 STKc_MASTL Catalytic domain of the Protein Serine/ 100.0
KOG0581|consensus364 99.98
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.98
KOG0616|consensus355 99.98
KOG0033|consensus355 99.98
KOG0590|consensus601 99.98
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.98
KOG0581|consensus364 99.98
KOG0588|consensus786 99.98
KOG0611|consensus668 99.97
KOG0594|consensus323 99.97
KOG0592|consensus604 99.97
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.97
KOG0585|consensus 576 99.97
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.97
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.97
KOG0585|consensus576 99.97
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.97
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.97
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.97
KOG0694|consensus694 99.97
KOG0580|consensus281 99.97
KOG0660|consensus359 99.97
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.97
KOG0578|consensus550 99.97
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.97
KOG0660|consensus359 99.97
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.97
KOG4717|consensus 864 99.97
KOG4236|consensus888 99.97
PHA03212391 serine/threonine kinase US3; Provisional 99.97
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.97
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.97
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.97
PTZ00036440 glycogen synthase kinase; Provisional 99.97
KOG0580|consensus281 99.97
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.97
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.97
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.97
PTZ00284467 protein kinase; Provisional 99.97
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.97
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.97
KOG0600|consensus560 99.97
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.97
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.97
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.97
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.97
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.97
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.96
KOG0201|consensus467 99.96
PTZ00267478 NIMA-related protein kinase; Provisional 99.96
KOG0198|consensus313 99.96
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.96
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.96
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.96
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.96
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.96
KOG0604|consensus400 99.96
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.96
KOG0661|consensus538 99.96
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.96
KOG0607|consensus463 99.96
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.96
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.96
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.96
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.96
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.96
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.96
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.96
KOG0658|consensus364 99.96
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.96
PHA03207392 serine/threonine kinase US3; Provisional 99.96
KOG0667|consensus586 99.96
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.96
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.96
KOG0597|consensus808 99.96
KOG0591|consensus375 99.96
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.96
KOG0658|consensus364 99.96
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.96
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.96
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.96
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.96
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.96
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.96
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.96
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 99.96
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.96
KOG0586|consensus596 99.96
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.96
KOG0662|consensus292 99.96
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.96
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.96
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.96
KOG0611|consensus 668 99.96
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.96
KOG0594|consensus323 99.96
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.96
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.96
KOG4717|consensus864 99.96
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.96
PHA03211461 serine/threonine kinase US3; Provisional 99.96
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.96
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.96
KOG0610|consensus459 99.96
KOG0690|consensus516 99.96
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.96
PTZ00283496 serine/threonine protein kinase; Provisional 99.96
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.96
KOG0586|consensus 596 99.96
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.96
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.96
PHA03209357 serine/threonine kinase US3; Provisional 99.96
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.96
PHA03210501 serine/threonine kinase US3; Provisional 99.96
KOG0663|consensus419 99.96
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.96
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.95
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.95
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.95
KOG0578|consensus550 99.95
KOG0591|consensus375 99.95
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.95
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.95
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.95
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.95
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.95
KOG0198|consensus313 99.95
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.95
KOG0659|consensus318 99.95
cd05610669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.95
KOG0612|consensus 1317 99.95
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.95
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.95
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.95
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.95
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.95
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.95
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.95
KOG0582|consensus516 99.95
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.95
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.95
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.95
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.95
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.95
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.95
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.95
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.95
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.95
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.95
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.95
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.95
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.95
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.95
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.95
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.95
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.95
KOG0610|consensus459 99.95
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.95
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.95
KOG0582|consensus516 99.95
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.95
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.95
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.95
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.95
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.95
KOG0579|consensus 1187 99.95
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.95
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.95
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.95
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.95
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.95
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.95
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.95
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.95
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.94
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.94
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.94
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.94
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.94
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.94
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.94
KOG4236|consensus888 99.94
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.94
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.94
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.94
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.94
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.94
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.94
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.94
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.94
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.94
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.94
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.94
KOG1290|consensus590 99.94
PLN00009294 cyclin-dependent kinase A; Provisional 99.94
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.94
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.94
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.94
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.94
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.94
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.94
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.94
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.94
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.94
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.94
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.94
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.94
PHA03212391 serine/threonine kinase US3; Provisional 99.94
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.94
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.94
KOG1035|consensus 1351 99.94
KOG0690|consensus516 99.94
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.94
PTZ00036440 glycogen synthase kinase; Provisional 99.94
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.94
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.94
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.94
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.94
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.94
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.94
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.94
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.94
KOG0612|consensus 1317 99.94
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.94
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.94
KOG0192|consensus362 99.94
KOG0666|consensus438 99.94
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.94
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.94
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.94
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.94
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.94
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.94
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.94
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.94
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.94
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.94
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.94
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.94
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.94
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.94
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.94
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.94
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.94
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.94
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.94
PTZ00267478 NIMA-related protein kinase; Provisional 99.94
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.94
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.94
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.94
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.94
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.94
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 99.94
KOG0579|consensus1187 99.94
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.93
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.93
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.93
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.93
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.93
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.93
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.93
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.93
KOG4645|consensus1509 99.93
KOG0696|consensus683 99.93
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.93
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.93
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.93
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.93
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.93
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.93
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.93
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.93
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.93
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.93
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.93
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.93
KOG0608|consensus1034 99.93
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.93
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.93
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.93
KOG4250|consensus732 99.93
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.93
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.93
KOG0577|consensus948 99.93
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.93
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.93
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.93
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.93
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.93
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.93
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.93
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.93
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.93
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.93
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.93
PLN03224507 probable serine/threonine protein kinase; Provisio 99.93
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.93
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.93
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.93
KOG1187|consensus361 99.93
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.93
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.93
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.93
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.93
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.93
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.93
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.93
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.93
KOG0201|consensus467 99.93
KOG0197|consensus468 99.93
KOG0589|consensus426 99.93
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.93
KOG0614|consensus732 99.93
PHA03209357 serine/threonine kinase US3; Provisional 99.93
KOG0614|consensus732 99.93
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.93
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.93
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.93
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.92
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.92
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.92
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.92
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.92
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.92
KOG0667|consensus586 99.92
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.92
PTZ00283496 serine/threonine protein kinase; Provisional 99.92
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.92
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.92
PTZ00284467 protein kinase; Provisional 99.92
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.92
KOG0608|consensus1034 99.92
KOG0577|consensus 948 99.92
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.92
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.92
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.92
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.92
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.92
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.92
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.92
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.92
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.92
PHA03207392 serine/threonine kinase US3; Provisional 99.92
KOG0669|consensus376 99.92
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.92
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.92
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.92
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.92
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.92
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.92
PHA02988283 hypothetical protein; Provisional 99.92
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.92
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.92
KOG4279|consensus1226 99.92
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.92
KOG4279|consensus 1226 99.92
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.92
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.92
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.92
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.92
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.92
KOG0574|consensus502 99.92
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.92
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.92
PTZ002661021 NIMA-related protein kinase; Provisional 99.92
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.92
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.92
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.92
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.92
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.92
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.92
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.92
KOG0986|consensus591 99.92
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.92
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.92
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.92
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.92
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.92
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.92
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.92
KOG1989|consensus 738 99.92
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.92
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.92
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.92
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.92
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.92
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.92
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.91
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.91
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.91
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.91
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.91
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.91
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.91
KOG0986|consensus591 99.91
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.91
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.91
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.91
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.91
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.91
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.91
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.91
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.91
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.91
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.91
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.91
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.91
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.91
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.91
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.91
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.91
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.91
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.91
PHA03211461 serine/threonine kinase US3; Provisional 99.91
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.91
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.91
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.91
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.91
KOG0695|consensus593 99.91
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.91
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.91
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.91
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.91
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.91
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.91
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 99.91
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.91
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.91
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.91
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.91
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.91
KOG0192|consensus362 99.91
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.91
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.91
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.91
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.91
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.91
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.91
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.91
KOG0576|consensus829 99.91
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.91
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.91
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.91
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.91
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.91
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.91
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.91
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.91
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.91
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.91
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.91
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.91
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.91
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.91
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.91
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.9
KOG1989|consensus738 99.9
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.9
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.9
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.9
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.9
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.9
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.9
KOG0596|consensus677 99.9
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.9
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.9
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.9
>KOG0603|consensus Back     alignment and domain information
Probab=100.00  E-value=2.9e-49  Score=467.14  Aligned_cols=553  Identities=23%  Similarity=0.340  Sum_probs=385.5

Q ss_pred             eecccCceEEEEEE---EcCCCcEEEEEEEecCCcch--HHHHHHHHHHHHhcC-CCCcceEEEEEEeCCeEEEEEecCC
Q psy5279         190 ELGRGVTGIVYHAV---ERSSGRNYAAKVMTGKGNQY--KSLFKNELDIMNQLC-HRNLVRLHDSYETKDSFTIISELAG  263 (1310)
Q Consensus       190 ~LG~GsFG~Vyka~---~k~Tg~~vAIKiI~~~~~~~--~~~~~rEI~IL~~L~-HPNIVkL~d~f~~~~~lyLVmEy~~  263 (1310)
                      ++|+|+||+|+++.   -.+.|..||+|+..+.....  +.....|..++...+ ||.+|+++..|+++..+|++++|..
T Consensus         1 vlg~g~~gkvfLvrk~~g~da~~~yamkvl~k~t~~~~~~~~t~~er~il~~~~~~~f~v~lhyafqt~~kl~l~ld~~r   80 (612)
T KOG0603|consen    1 VLGQGSYGKVFLVRKAGGADAGHLYAMKVLKKATLKVRDRTHTKQERIILAFVHNTPFLVKLHYAFQTDGKLYLILDFLR   80 (612)
T ss_pred             CCCcCCCcchHHHHHhccccccchhhhhcccccccccccccccccHHHHHhhccCCCceeeeeeeeccccchhHhhhhcc
Confidence            47999999998654   34678899999987654322  223456888899987 9999999999999999999999999


Q ss_pred             CCchHHHhhhcCCCCHHHHHHHHHHHHHHHHHhhhCCeeecCCCCCCEEeecCCCCeEEEEeeccceeecCCCCCCCccc
Q psy5279         264 GGELLHSLTRQSYYTEYDIAHYIRQLLSGLDYMHRLSIAHLGLTPGDLLVAHPGGRHLLLTDFGLSRRITSFGKLNPLEY  343 (1310)
Q Consensus       264 GGeL~~~l~~~~~lsE~~i~~ii~QIl~GL~YLHs~gIVHRDLKPeNILL~~~~~~~VKLsDFGLAr~i~~~~~l~~~~~  343 (1310)
                      ||+|+.++.....+++.+.+.+...++.|++++|+.+|+|||+|++||+++.+|  ++|+.|||++|........   ||
T Consensus        81 gg~lft~l~~~~~f~~~~~~~~~aelaLald~lh~l~iiyrd~k~enilld~~G--hi~~tdfglske~v~~~~~---cg  155 (612)
T KOG0603|consen   81 GGDLFTRLSKEVMFDELDVAFYLAELALALDHLHKLGIAYRDYKLENVLLLLEG--HIKLTDFGLSKEAVKEKIA---CG  155 (612)
T ss_pred             cchhhhccccCCchHHHHHHHHHHHHHHHHhhcchhHHHHhcccccceeecccC--ccccCCchhhhHhHhhhhc---cc
Confidence            999999999988999999999999999999999999999999999999998776  8999999999987654433   88


Q ss_pred             chHHHhhhcCCCccccCCCCCCCCCCCcchhhhhhhcccchhhchhhhhhhcccCCCCCCccCCCcceecCCCCCCCCCC
Q psy5279         344 DVRYVRQALRHPWLNFADRKPTEDTPKLNTDALRNYYNLYKDWYGNAAVRRYYRRRPLNSCYTHPSRMIYPPGTQFTPEP  423 (1310)
Q Consensus       344 t~~yv~~~~r~P~l~~~~~~~~~~~p~~~~~~~~~~~~~~~D~~~~~~l~~~~~r~~~~~cl~hpw~~~~~~~~~~tp~~  423 (1310)
                      |..|++     |++.                   +-...+.|||+.             .+++.+.+++..||+..+...
T Consensus       156 t~eymA-----pEI~-------------------~gh~~a~D~ws~-------------gvl~felltg~~pf~~~~~~~  198 (612)
T KOG0603|consen  156 TYEYRA-----PEII-------------------NGHLSAADWWSF-------------GVLAFELLTGTLPFGGDTMKR  198 (612)
T ss_pred             chhhhh-----hHhh-------------------hccCCcccchhh-------------hhhHHHHhhCCCCCchHHHHH
Confidence            888775     4432                   113346898776             566666777777776633222


Q ss_pred             CCc-ceecccccccccccccccCCCCCCCcccc-cCCCCCCCCc--hhhHHHHhccCCCHHHHHHHHHHHHHHhhhhccC
Q psy5279         424 TPD-KVLVSRDLRDVKTWEDNVPNRGPDVKTWE-DNVPNRGPGG--ELLHSLTRQSYYTEYDIAHYIRQLLSGLDYMHRL  499 (1310)
Q Consensus       424 ~p~-~i~v~~~~rD~~~~~~~~~~~~~~~i~~~-d~v~e~~~~~--el~~~~~~~~~~~e~~~~~~~~qi~~~~~y~H~~  499 (1310)
                      ++. +..++          .-+...+++++... --+++..-|.  +..+-|+++..|.--+-        .++.+--  
T Consensus       199 Il~~~~~~p----------~~l~~~a~~~~~~l~~r~p~nrLg~~~~~~~eik~h~f~~~i~~--------~~l~~r~--  258 (612)
T KOG0603|consen  199 ILKAELEMP----------RELSAEARSLFRQLFKRNPENRLGAGPDGVDEIKQHEFFQSIDW--------NELEARS--  258 (612)
T ss_pred             HhhhccCCc----------hhhhHHHHHHHHHHHhhCHHHHhccCcchhHHHhccchheeeeH--------hhHhhcC--
Confidence            222 11111          12223333333333 2233333333  45566666554321100        0111100  


Q ss_pred             CceecCCCCCCeEeccCCCCcEEEecccccchhccccccCCCCCCCCce-eEeechhhhhHHHHhhcCCccccCCCCCCC
Q psy5279         500 SIAHLGLTPGDLLVAHPGGRHLLLTDFGLSRRITSFGKLNPLEYGNGQY-KVAVTPAMKHLQAITEAGHTPTLAQDPPPL  578 (1310)
Q Consensus       500 ~i~hrDlkp~Nil~~~~~~~~ikl~DfG~a~~~~~~~~~~~~~~~~~~~-~~~~t~~~~~~~~~~~~~~~~~~~~~~~~~  578 (1310)
                        +|-=.||.=.                           ...-+..+.+ -..-||++.++----++.|++  ..+++-.
T Consensus       259 --~~~~fkp~~~---------------------------~e~~~~~fd~eft~~~P~dsp~~~~~~s~~~i--f~g~sfv  307 (612)
T KOG0603|consen  259 --RPPPFKPGSI---------------------------TERDVAQFDPEFTSQVPADSPLLSASGSDHTI--FSGPSFV  307 (612)
T ss_pred             --CCCCCCCccc---------------------------chhhhhhcCchhccCCcccCCCCCCCccccch--hcCCCcc
Confidence              0111122110                           0011111112 123456665543333333332  2333332


Q ss_pred             CCccccCCCccccCCCCCcchhhhhhccccchhhhHHHHhhccccceeeeecccCcchhhhhhHHhh-hhhhhchhhHHH
Q psy5279         579 NYSVEDSPIEWSTEPPTDKYQFISEIHRGKFSVVVKAAEKANTENLVAAKLFEYSHDTLHQVNTEFD-NLRSLRHERIAS  657 (1310)
Q Consensus       579 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~  657 (1310)
                      .-++-..   =.+-|.++.|.|..+|-.|-||+|..|.-++ |..-.+.|+++-+.+   +.-.|-. .++--.|++|.+
T Consensus       308 a~~il~~---~~~~~~~~~y~~~~~~~~gs~s~~~~~~~~~-t~~~~~vkii~~~~~---~~~~e~~~~~~~~~h~niv~  380 (612)
T KOG0603|consen  308 APGVLED---AVTAPFTESYEFREELGEGSFSAVKYCESSP-TDQEPAVKIISKRAD---DNQDEIPISLLVRDHPNIVK  380 (612)
T ss_pred             ChHHhhc---cccCCcchhhccccccCCCCccceeeeeccc-cccchhheecccccc---ccccccchhhhhcCCCccee
Confidence            2222211   2345679999999999999999999999998 999999999988722   2223332 345557999999


Q ss_pred             HHHhcCCCCcccchhhHHHHhhcCchhhhhhhccccchhhhHHHHHHHhHHHHhhhhhhhhhcccccCCCchhhHHHhhh
Q psy5279         658 LLEAYKPSTTASNIAVLVMEKLQGADVLSYLSSRHEYTEQNVATIISQAWEHYLKKNREQIADTADKSRIPRTIREYREQ  737 (1310)
Q Consensus       658 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  737 (1310)
                      ++.-|--.    -.+-+|||+++|.++|..+-+-.+                                            
T Consensus       381 ~~~v~~~~----~~~~~v~e~l~g~ell~ri~~~~~--------------------------------------------  412 (612)
T KOG0603|consen  381 SHDVYEDG----KEIYLVMELLDGGELLRRIRSKPE--------------------------------------------  412 (612)
T ss_pred             ecceecCC----ceeeeeehhccccHHHHHHHhcch--------------------------------------------
Confidence            99999887    567799999999987743211000                                            


Q ss_pred             hcccccccccccccCCCCCCCCcccccccccccccccccCCcchhhccccCCcchhhHHHHHHhcCCCCccccccccccc
Q psy5279         738 SANTANLRDVKTWEDNVPNRGPAIDYDLNVVKSESHYQNGPDTYLLQLRDVDFPVRLREYIKVASTRPDLRLSTGFNCLD  817 (1310)
Q Consensus       738 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  817 (1310)
                                                                                                      
T Consensus       413 --------------------------------------------------------------------------------  412 (612)
T KOG0603|consen  413 --------------------------------------------------------------------------------  412 (612)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CCCCCCCCCCcchhhhcccccccchhhhHHHHHhhhhccccccchhhhhhhcccCCCchhhHhHHHHHhhhcCCCCCcee
Q psy5279         818 TSENGHLDWKAPVIRERRRFTDVMDEEIDDERRNRINKYGAADTYTLRRLRHEIGTRPEAHVEADALIESRRDGHAPFFR  897 (1310)
Q Consensus       818 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~l~~e~~~~~~~~~~a~~~ie~~~~~~~~ffr  897 (1310)
                                                                                                      
T Consensus       413 --------------------------------------------------------------------------------  412 (612)
T KOG0603|consen  413 --------------------------------------------------------------------------------  412 (612)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             ecceeeeeeeCCEEEEEEeccCCCcceeeecccCCcccccccccCCCchhHHHHHHHHHHHHHHHHHCCceecccCCCcE
Q psy5279         898 EKPITIPVVIGDKLEMKCLAVGEPKPVIQWFKLGTSTLCYLPIVIPTTHKDAYCVTSVLDGLQYLHWRGLCHLNIEPDNV  977 (1310)
Q Consensus       898 E~~~~~~l~~g~~l~~~~l~~G~p~~vi~~f~~g~~l~~~L~~~i~~~~~~~~i~~QIl~AL~yLHs~gIVHRDLKPeNI  977 (1310)
                                                                   .+ ..+..+++||+.|++|||++|||||||||+||
T Consensus       413 ---------------------------------------------~~-~e~~~w~~~lv~Av~~LH~~gvvhRDLkp~NI  446 (612)
T KOG0603|consen  413 ---------------------------------------------FC-SEASQWAAELVSAVDYLHEQGVVHRDLKPGNI  446 (612)
T ss_pred             ---------------------------------------------hH-HHHHHHHHHHHHHHHHHHhcCeeecCCChhhe
Confidence                                                         00 12456788999999999999999999999999


Q ss_pred             EEeecCCCcEEEEeeccceeeccCCcccccCCCCCCcccccccccCCCCCCccchhHHHHHHHHHhcCCCCCCCCChhHH
Q psy5279         978 VMASVRSVQVKLIDLGCTQRVTKLGTLIHPINTPNPEFAAPEVLAEEPIFPQTDVWSAGVLAYVLLSGASPFRGQSEPET 1057 (1310)
Q Consensus       978 Ll~~~~~~~VKL~DFGlAk~~~~~g~~~~~~~tGtp~Y~APEvl~~~~ys~ksDIWSLGViLyeLLtG~~PF~g~~~~e~ 1057 (1310)
                      |++ +..++++|+|||.++.....  ..+      |                                            
T Consensus       447 L~~-~~~g~lrltyFG~a~~~~~~--~~t------p--------------------------------------------  473 (612)
T KOG0603|consen  447 LLD-GSAGHLRLTYFGFWSELERS--CDT------P--------------------------------------------  473 (612)
T ss_pred             eec-CCCCcEEEEEechhhhCchh--hcc------c--------------------------------------------
Confidence            996 23567999999987643211  000      0                                            


Q ss_pred             HhhhccccccccccchhccHHHHHHHHHhccCCcchhcHHhhhCCCcccccccccccccccccccccccCCcccCCCccc
Q psy5279        1058 RQNVNFVRYRFEYLFKELTQEATRFLMLIFKHEVDWITLANNIDHEFWHVKDLKRETNYTFRLSAKNVIGWSEKGIPSAL 1137 (1310)
Q Consensus      1058 ~~~I~~~~~~f~~~~~~lS~eakdLL~~il~~~~~rit~~e~L~H~f~~~~~l~~~~~~~~rlsa~~~i~~s~~~ips~l 1137 (1310)
                                                                                                     .
T Consensus       474 -------------------------------------------------------------------------------~  474 (612)
T KOG0603|consen  474 -------------------------------------------------------------------------------A  474 (612)
T ss_pred             -------------------------------------------------------------------------------c
Confidence                                                                                           0


Q ss_pred             ccccccchhhcccCCCCccccchhhhhHHHHHhcCCCCCCCCChh-hhhhcccccccccccchhccCHHHHHHHHHhhhc
Q psy5279        1138 FKTKEQAPEVLAEEPIFPQTDVWSAGVLAYVLLSGASPFRGQSEP-ETRQNVNFVRYRFEYLFKELTQEATRFLMLIFKR 1216 (1310)
Q Consensus      1138 f~~~~qAPEVl~~~~y~~a~DIWSlGVI~Y~LLsG~~PF~g~~~~-e~~~~I~~~~~~f~~~~~~iS~eAkdfI~~lL~~ 1216 (1310)
                      +...+.||||++..+|+++|||||+||++|+||+|.+||...... ++...|..++++     .+||.+|||||++||+.
T Consensus       475 ~t~~y~APEvl~~~~yt~acD~WSLGvlLy~ML~G~tp~~~~P~~~ei~~~i~~~~~s-----~~vS~~AKdLl~~LL~~  549 (612)
T KOG0603|consen  475 LTLQYVAPEVLAIQEYTEACDWWSLGVLLYEMLTGRTLFAAHPAGIEIHTRIQMPKFS-----ECVSDEAKDLLQQLLQV  549 (612)
T ss_pred             hhhcccChhhhccCCCCcchhhHHHHHHHHHHHhCCCccccCCchHHHHHhhcCCccc-----cccCHHHHHHHHHhccC
Confidence            122456888888889999999999999999999999999877655 777878777654     57999999999999999


Q ss_pred             CCCCCCCHHHhhcCCcc
Q psy5279        1217 APGKRPTVEECHENRWL 1233 (1310)
Q Consensus      1217 dP~kRpTa~e~L~HpWl 1233 (1310)
                      ||.+|||+.|++.|||+
T Consensus       550 dP~~Rl~~~~i~~h~w~  566 (612)
T KOG0603|consen  550 DPALRLGADEIGAHPWF  566 (612)
T ss_pred             ChhhCcChhhhccCcch
Confidence            99999999999999999



>KOG0615|consensus Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>KOG0662|consensus Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>KOG1290|consensus Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>KOG0666|consensus Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG4645|consensus Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0669|consensus Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>KOG1989|consensus Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>KOG1989|consensus Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>KOG0596|consensus Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1310
1kob_A387 Twitchin Kinase Fragment (Aplysia), Autoregulated P 6e-25
1kob_A387 Twitchin Kinase Fragment (Aplysia), Autoregulated P 8e-21
1kob_A387 Twitchin Kinase Fragment (Aplysia), Autoregulated P 5e-14
2x4f_A373 The Crystal Structure Of The Human Myosin Light Cha 6e-24
2x4f_A373 The Crystal Structure Of The Human Myosin Light Cha 5e-20
2x4f_A373 The Crystal Structure Of The Human Myosin Light Cha 6e-11
2ya9_A361 Crystal Structure Of The Autoinhibited Form Of Mous 5e-22
2ya9_A361 Crystal Structure Of The Autoinhibited Form Of Mous 7e-20
2ya9_A361 Crystal Structure Of The Autoinhibited Form Of Mous 6e-15
1wmk_A321 Human Death-Associated Kinase Drp-1, Mutant S308d D 5e-22
1wmk_A321 Human Death-Associated Kinase Drp-1, Mutant S308d D 9e-20
1wmk_A321 Human Death-Associated Kinase Drp-1, Mutant S308d D 5e-14
2a27_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 5e-22
2a27_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 7e-20
2a27_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 3e-14
2a2a_A321 High-resolution Crystallographic Analysis Of The Au 6e-22
2a2a_A321 High-resolution Crystallographic Analysis Of The Au 2e-19
2a2a_A321 High-resolution Crystallographic Analysis Of The Au 6e-14
1z9x_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 6e-22
1z9x_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 2e-19
1z9x_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 6e-14
3bhy_A283 Crystal Structure Of Human Death Associated Protein 6e-22
3bhy_A283 Crystal Structure Of Human Death Associated Protein 4e-13
1zws_A288 Crystal Structure Of The Catalytic Domain Of Human 7e-22
1zws_A288 Crystal Structure Of The Catalytic Domain Of Human 1e-19
1zws_A288 Crystal Structure Of The Catalytic Domain Of Human 8e-13
3gu4_A295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 2e-21
3gu4_A295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 2e-19
3gu4_A295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 2e-13
2w4o_A349 Crystal Structure Of Human Camk4 In Complex With 4- 2e-21
2w4o_A349 Crystal Structure Of Human Camk4 In Complex With 4- 2e-09
2j90_A304 Crystal Structure Of Human Zip Kinase In Complex Wi 3e-21
2j90_A304 Crystal Structure Of Human Zip Kinase In Complex Wi 2e-12
1yrp_A278 Catalytic Domain Of Human Zip Kinase Phosphorylated 5e-21
1yrp_A278 Catalytic Domain Of Human Zip Kinase Phosphorylated 2e-12
1koa_A491 Twitchin Kinase Fragment (C.Elegans), Autoregulated 6e-21
1koa_A491 Twitchin Kinase Fragment (C.Elegans), Autoregulated 1e-18
1koa_A 491 Twitchin Kinase Fragment (C.Elegans), Autoregulated 2e-11
3uto_A573 Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- 7e-21
3uto_A573 Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- 1e-18
3uto_A573 Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- 2e-11
3gu8_A295 Crystal Structure Of Dapkl93g With N6-Cyclopentylad 8e-21
3gu8_A295 Crystal Structure Of Dapkl93g With N6-Cyclopentylad 2e-19
3gu8_A295 Crystal Structure Of Dapkl93g With N6-Cyclopentylad 2e-13
1ig1_A294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 1e-20
1ig1_A294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 2e-19
1ig1_A294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 2e-13
2w4k_A302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 1e-20
2w4k_A302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 2e-19
2w4k_A302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 2e-13
3f5u_A295 Crystal Structure Of The Death Associated Protein K 1e-20
3f5u_A295 Crystal Structure Of The Death Associated Protein K 2e-19
3f5u_A295 Crystal Structure Of The Death Associated Protein K 2e-13
1p4f_A293 Death Associated Protein Kinase Catalytic Domain Wi 1e-20
1p4f_A293 Death Associated Protein Kinase Catalytic Domain Wi 2e-19
1p4f_A293 Death Associated Protein Kinase Catalytic Domain Wi 2e-13
3dfc_B295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 1e-20
3dfc_B295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 2e-19
3dfc_B295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 2e-13
2x0g_A334 X-ray Structure Of A Dap-kinase Calmodulin Complex 1e-20
2x0g_A334 X-ray Structure Of A Dap-kinase Calmodulin Complex 2e-19
2x0g_A334 X-ray Structure Of A Dap-kinase Calmodulin Complex 1e-13
2xzs_A312 Death Associated Protein Kinase 1 Residues 1-312 Le 1e-20
2xzs_A312 Death Associated Protein Kinase 1 Residues 1-312 Le 2e-19
2xzs_A312 Death Associated Protein Kinase 1 Residues 1-312 Le 2e-13
2xuu_A334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 1e-20
2xuu_A334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 1e-18
2xuu_A334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 1e-13
3kk9_A282 Camkii Substrate Complex B Length = 282 1e-20
3kk9_A282 Camkii Substrate Complex B Length = 282 7e-12
3kk9_A282 Camkii Substrate Complex B Length = 282 6e-04
3kk8_A284 Camkii Substrate Complex A Length = 284 1e-20
3kk8_A284 Camkii Substrate Complex A Length = 284 7e-12
3kk8_A284 Camkii Substrate Complex A Length = 284 6e-04
3kl8_A269 Camkiintide Inhibitor Complex Length = 269 2e-20
3kl8_A269 Camkiintide Inhibitor Complex Length = 269 6e-12
3kl8_A269 Camkiintide Inhibitor Complex Length = 269 7e-04
2yak_A285 Structure Of Death-Associated Protein Kinase 1 (Dap 2e-20
2yak_A285 Structure Of Death-Associated Protein Kinase 1 (Dap 2e-19
2yak_A285 Structure Of Death-Associated Protein Kinase 1 (Dap 1e-13
1wvw_A278 Crystal Structures Of Kinase Domain Of Dap Kinase I 2e-20
1wvw_A278 Crystal Structures Of Kinase Domain Of Dap Kinase I 5e-19
1wvw_A278 Crystal Structures Of Kinase Domain Of Dap Kinase I 2e-13
2w4j_A277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 2e-20
2w4j_A277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 5e-19
2w4j_A277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 2e-13
2bdw_A362 Crystal Structure Of The Auto-Inhibited Kinase Doma 2e-20
2bdw_A362 Crystal Structure Of The Auto-Inhibited Kinase Doma 3e-12
2bdw_A362 Crystal Structure Of The Auto-Inhibited Kinase Doma 6e-04
2y0a_A326 Structure Of Dapk1 Construct Residues 1-304 Length 2e-20
2y0a_A326 Structure Of Dapk1 Construct Residues 1-304 Length 2e-19
2y0a_A326 Structure Of Dapk1 Construct Residues 1-304 Length 1e-13
2jc6_A334 Crystal Structure Of Human Calmodulin-Dependent Pro 2e-20
2jc6_A334 Crystal Structure Of Human Calmodulin-Dependent Pro 4e-13
2jc6_A334 Crystal Structure Of Human Calmodulin-Dependent Pro 3e-09
2wel_A327 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 2e-18
2wel_A327 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 1e-10
2wel_A327 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 4e-05
3lm0_A327 Crystal Structure Of Human SerineTHREONINE KINASE 1 2e-18
3lm0_A327 Crystal Structure Of Human SerineTHREONINE KINASE 1 1e-13
3bhh_A295 Crystal Structure Of Human Calcium/calmodulin-depen 2e-18
3bhh_A295 Crystal Structure Of Human Calcium/calmodulin-depen 3e-10
3bhh_A295 Crystal Structure Of Human Calcium/calmodulin-depen 6e-05
2v7o_A336 Crystal Structure Of Human Calcium-Calmodulin-Depen 3e-18
2v7o_A336 Crystal Structure Of Human Calcium-Calmodulin-Depen 2e-10
2v7o_A336 Crystal Structure Of Human Calcium-Calmodulin-Depen 2e-05
2vn9_A301 Crystal Structure Of Human Calcium Calmodulin Depen 3e-18
2vn9_A301 Crystal Structure Of Human Calcium Calmodulin Depen 2e-10
2vn9_A301 Crystal Structure Of Human Calcium Calmodulin Depen 4e-05
2jam_A304 Crystal Structure Of Human Calmodulin-Dependent Pro 6e-18
2jam_A304 Crystal Structure Of Human Calmodulin-Dependent Pro 5e-13
2jam_A304 Crystal Structure Of Human Calmodulin-Dependent Pro 3e-09
3soa_A444 Full-Length Human Camkii Length = 444 7e-18
3soa_A444 Full-Length Human Camkii Length = 444 4e-11
3soa_A444 Full-Length Human Camkii Length = 444 8e-05
2vz6_A313 Structure Of Human Calcium Calmodulin Dependent Pro 1e-17
2vz6_A313 Structure Of Human Calcium Calmodulin Dependent Pro 1e-10
2vz6_A313 Structure Of Human Calcium Calmodulin Dependent Pro 8e-05
1tki_A321 Autoinhibited Serine Kinase Domain Of The Giant Mus 2e-17
1tki_A321 Autoinhibited Serine Kinase Domain Of The Giant Mus 5e-17
1tki_A321 Autoinhibited Serine Kinase Domain Of The Giant Mus 5e-09
1a06_A332 Calmodulin-Dependent Protein Kinase From Rat Length 3e-17
1a06_A332 Calmodulin-Dependent Protein Kinase From Rat Length 8e-13
1a06_A332 Calmodulin-Dependent Protein Kinase From Rat Length 1e-09
3ma6_A298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 4e-17
3ma6_A298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 6e-12
3ma6_A298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 2e-06
3i79_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 6e-17
3i79_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 6e-12
3i79_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 1e-06
4fg9_A320 Crystal Structure Of Human Calcium/calmodulin-depen 7e-17
4fg9_A320 Crystal Structure Of Human Calcium/calmodulin-depen 9e-13
4fg9_A320 Crystal Structure Of Human Calcium/calmodulin-depen 1e-09
4fg8_A315 Crystal Structure Of Human Calcium/calmodulin-depen 7e-17
4fg8_A315 Crystal Structure Of Human Calcium/calmodulin-depen 9e-13
4fg8_A315 Crystal Structure Of Human Calcium/calmodulin-depen 1e-09
3ku2_A507 Crystal Structure Of Inactivated Form Of Cdpk1 From 1e-16
3ku2_A507 Crystal Structure Of Inactivated Form Of Cdpk1 From 4e-12
3ku2_A 507 Crystal Structure Of Inactivated Form Of Cdpk1 From 1e-06
4fg7_A293 Crystal Structure Of Human Calcium/calmodulin-depen 1e-16
4fg7_A293 Crystal Structure Of Human Calcium/calmodulin-depen 1e-12
4fg7_A293 Crystal Structure Of Human Calcium/calmodulin-depen 8e-10
3hx4_A508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 1e-16
3hx4_A508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 4e-12
3hx4_A 508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 1e-06
3igo_A486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 2e-16
3igo_A486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 2e-13
3igo_A 486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 3e-07
3f3z_A277 Crystal Structure Of Cryptosporidium Parvum Calcium 3e-16
3f3z_A277 Crystal Structure Of Cryptosporidium Parvum Calcium 4e-08
3f3z_A277 Crystal Structure Of Cryptosporidium Parvum Calcium 2e-04
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 3e-16
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 3e-13
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 2e-07
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 3e-16
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 3e-13
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 2e-07
2qg5_A294 Cryptosporidium Parvum Calcium Dependent Protein Ki 3e-16
2qg5_A294 Cryptosporidium Parvum Calcium Dependent Protein Ki 5e-08
2qg5_A294 Cryptosporidium Parvum Calcium Dependent Protein Ki 2e-04
3i7c_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 6e-16
3i7c_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 5e-11
3i7c_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 2e-06
3hko_A345 Crystal Structure Of A Cdpk Kinase Domain From Cryp 1e-15
3hko_A345 Crystal Structure Of A Cdpk Kinase Domain From Cryp 2e-04
2z7q_A321 Crystal Structure Of The N-Terminal Kinase Domain O 5e-14
2z7q_A321 Crystal Structure Of The N-Terminal Kinase Domain O 2e-07
2z7q_A321 Crystal Structure Of The N-Terminal Kinase Domain O 2e-06
2z7q_A321 Crystal Structure Of The N-Terminal Kinase Domain O 7e-04
3q5i_A504 Crystal Structure Of Pbanka_031420 Length = 504 7e-14
3q5i_A 504 Crystal Structure Of Pbanka_031420 Length = 504 3e-10
3dxn_A287 Crystal Structure Of The Calcium-dependent Kinase F 9e-14
3dxn_A287 Crystal Structure Of The Calcium-dependent Kinase F 3e-12
3dxn_A287 Crystal Structure Of The Calcium-dependent Kinase F 3e-08
3g51_A325 Structural Diversity Of The Active Conformation Of 1e-13
3g51_A325 Structural Diversity Of The Active Conformation Of 8e-07
3g51_A325 Structural Diversity Of The Active Conformation Of 9e-06
3g51_A325 Structural Diversity Of The Active Conformation Of 5e-04
3hzt_A467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 1e-13
3hzt_A467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 3e-12
3hzt_A 467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 3e-08
2phk_A277 The Crystal Structure Of A Phosphorylase Kinase Pep 2e-13
2phk_A277 The Crystal Structure Of A Phosphorylase Kinase Pep 8e-05
3ubd_A304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 2e-13
3ubd_A304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 1e-06
3ubd_A304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 1e-05
3ubd_A304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 5e-04
4el9_A305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 2e-13
4el9_A305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 1e-06
4el9_A305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 9e-06
4el9_A305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 5e-04
1phk_A298 Two Structures Of The Catalytic Domain Of Phosphory 2e-13
1phk_A298 Two Structures Of The Catalytic Domain Of Phosphory 8e-05
1ql6_A298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 2e-13
1ql6_A298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 1e-04
4fie_A423 Full-Length Human Pak4 Length = 423 4e-13
4fie_A423 Full-Length Human Pak4 Length = 423 6e-07
2q0n_A301 Structure Of Human P21 Activating Kinase 4 (Pak4) I 6e-13
2q0n_A301 Structure Of Human P21 Activating Kinase 4 (Pak4) I 1e-06
2cdz_A303 Crystal Structure Of The Human P21-Activated Kinase 7e-13
2cdz_A303 Crystal Structure Of The Human P21-Activated Kinase 1e-06
3mfr_A351 Cask-4m Cam Kinase Domain, Native Length = 351 7e-13
3mfr_A351 Cask-4m Cam Kinase Domain, Native Length = 351 4e-05
2bva_A292 Crystal Structure Of The Human P21-Activated Kinase 9e-13
2bva_A292 Crystal Structure Of The Human P21-Activated Kinase 1e-06
3lij_A494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 1e-12
3lij_A494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 3e-11
3lij_A 494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 7e-06
2x4z_A296 Crystal Structure Of The Human P21-Activated Kinase 1e-12
2x4z_A296 Crystal Structure Of The Human P21-Activated Kinase 1e-06
3q4z_A306 Structure Of Unphosphorylated Pak1 Kinase Domain Le 1e-12
3q4z_A306 Structure Of Unphosphorylated Pak1 Kinase Domain Le 2e-07
4fif_A346 Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid 1e-12
4fif_A346 Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid 1e-06
3q52_A306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 1e-12
3q52_A306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 2e-06
2y7j_A365 Structure Of Human Phosphorylase Kinase, Gamma 2 Le 1e-12
2y7j_A365 Structure Of Human Phosphorylase Kinase, Gamma 2 Le 2e-06
1yhv_A297 Crystal Structure Of Pak1 Kinase Domain With Two Po 2e-12
1yhv_A297 Crystal Structure Of Pak1 Kinase Domain With Two Po 1e-06
3fxz_A297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 2e-12
3fxz_A297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 2e-06
1f3m_C297 Crystal Structure Of Human SerineTHREONINE KINASE P 2e-12
1f3m_C297 Crystal Structure Of Human SerineTHREONINE KINASE P 6e-07
2r5t_A373 Crystal Structure Of Inactive Serum And Glucocortic 2e-12
2r5t_A373 Crystal Structure Of Inactive Serum And Glucocortic 6e-06
2c30_A321 Crystal Structure Of The Human P21-Activated Kinase 2e-12
2c30_A321 Crystal Structure Of The Human P21-Activated Kinase 9e-06
2jfl_A325 Crystal Structure Of Human Ste20-Like Kinase ( Diph 7e-12
1mrv_A339 Crystal Structure Of An Inactive Akt2 Kinase Domain 7e-12
1mrv_A339 Crystal Structure Of An Inactive Akt2 Kinase Domain 1e-06
2j51_A325 Crystal Structure Of Human Ste20-Like Kinase Bound 8e-12
2jfm_A325 Crystal Structure Of Human Ste20-Like Kinase (Unlig 8e-12
2f57_A317 Crystal Structure Of The Human P21-activated Kinase 1e-11
2f57_A317 Crystal Structure Of The Human P21-activated Kinase 2e-07
2vrx_A285 Structure Of Aurora B Kinase In Complex With Zm4474 2e-11
2vrx_A285 Structure Of Aurora B Kinase In Complex With Zm4474 2e-07
2bfx_B284 Mechanism Of Aurora-B Activation By Incenp And Inhi 2e-11
2bfx_B284 Mechanism Of Aurora-B Activation By Incenp And Inhi 2e-07
2qnj_A328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 2e-11
2qnj_A328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 1e-08
1o6l_A337 Crystal Structure Of An Activated Akt/protein Kinas 3e-11
1o6l_A337 Crystal Structure Of An Activated Akt/protein Kinas 1e-06
3ka0_A320 Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4 3e-11
3ka0_A320 Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4 5e-06
2jdo_A342 Structure Of Pkb-Beta (Akt2) Complexed With Isoquin 3e-11
2jdo_A342 Structure Of Pkb-Beta (Akt2) Complexed With Isoquin 1e-06
1o6k_A336 Structure Of Activated Form Of Pkb Kinase Domain S4 4e-11
1o6k_A336 Structure Of Activated Form Of Pkb Kinase Domain S4 1e-06
1gzn_A335 Structure Of Pkb Kinase Domain Length = 335 4e-11
1gzn_A335 Structure Of Pkb Kinase Domain Length = 335 2e-06
3e87_A335 Crystal Structures Of The Kinase Domain Of Akt2 In 4e-11
3e87_A335 Crystal Structures Of The Kinase Domain Of Akt2 In 1e-06
2oza_A356 Structure Of P38alpha Complex Length = 356 4e-11
2oza_A356 Structure Of P38alpha Complex Length = 356 4e-06
1gzk_A315 Molecular Mechanism For The Regulation Of Protein K 4e-11
1gzk_A315 Molecular Mechanism For The Regulation Of Protein K 2e-06
1kwp_A400 Crystal Structure Of Mapkap2 Length = 400 4e-11
1kwp_A400 Crystal Structure Of Mapkap2 Length = 400 5e-06
4fr4_A384 Crystal Structure Of Human SerineTHREONINE-Protein 4e-11
2onl_C406 Crystal Structure Of The P38a-Mapkap Kinase 2 Heter 4e-11
2onl_C406 Crystal Structure Of The P38a-Mapkap Kinase 2 Heter 4e-06
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 5e-11
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 1e-08
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 2e-05
3fe3_A328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 5e-11
3fe3_A328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 1e-08
2p3g_X327 Crystal Structure Of A Pyrrolopyridine Inhibitor Bo 5e-11
2p3g_X327 Crystal Structure Of A Pyrrolopyridine Inhibitor Bo 5e-06
2jbo_A326 Protein Kinase Mk2 In Complex With An Inhibitor (Cr 5e-11
2jbo_A326 Protein Kinase Mk2 In Complex With An Inhibitor (Cr 5e-06
3r2y_A319 Mk2 Kinase Bound To Compound 1 Length = 319 5e-11
3r2y_A319 Mk2 Kinase Bound To Compound 1 Length = 319 5e-06
3r2b_A318 Mk2 Kinase Bound To Compound 5b Length = 318 5e-11
3r2b_A318 Mk2 Kinase Bound To Compound 5b Length = 318 4e-06
3fpm_A325 Crystal Structure Of A Squarate Inhibitor Bound To 5e-11
3fpm_A325 Crystal Structure Of A Squarate Inhibitor Bound To 6e-06
2pzy_A324 Structure Of Mk2 Complexed With Compound 76 Length 5e-11
2pzy_A324 Structure Of Mk2 Complexed With Compound 76 Length 6e-06
3gok_A334 Binding Site Mapping Of Protein Ligands Length = 33 6e-11
3gok_A334 Binding Site Mapping Of Protein Ligands Length = 33 5e-06
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 6e-11
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 7e-09
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 2e-05
2qr7_A342 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of 6e-11
2qr7_A342 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of 4e-08
2ac5_A316 Structure Of Human Mnk2 Kinase Domain Mutant D228g 7e-11
2ac5_A316 Structure Of Human Mnk2 Kinase Domain Mutant D228g 4e-09
1nxk_A400 Crystal Structure Of Staurosporine Bound To Map Kap 7e-11
1nxk_A400 Crystal Structure Of Staurosporine Bound To Map Kap 2e-05
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 7e-11
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 9e-09
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 2e-05
3o96_A446 Crystal Structure Of Human Akt1 With An Allosteric 7e-11
3o96_A446 Crystal Structure Of Human Akt1 With An Allosteric 2e-04
3kn5_A325 Crystal Structure Of The C-Terminal Kinase Domain O 8e-11
3kn5_A325 Crystal Structure Of The C-Terminal Kinase Domain O 2e-07
3kn5_A325 Crystal Structure Of The C-Terminal Kinase Domain O 1e-04
4ejn_A446 Crystal Structure Of Autoinhibited Form Of Akt1 In 8e-11
4ejn_A446 Crystal Structure Of Autoinhibited Form Of Akt1 In 3e-04
3c0g_A351 Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len 8e-11
3c0g_A351 Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len 4e-05
3tac_A361 Crystal Structure Of The Liprin-AlphaCASK COMPLEX L 9e-11
3tac_A361 Crystal Structure Of The Liprin-AlphaCASK COMPLEX L 4e-05
2qr8_A342 2.0a X-ray Structure Of C-terminal Kinase Domain Of 9e-11
2qr8_A342 2.0a X-ray Structure Of C-terminal Kinase Domain Of 8e-09
3com_A314 Crystal Structure Of Mst1 Kinase Length = 314 1e-10
3com_A314 Crystal Structure Of Mst1 Kinase Length = 314 4e-04
2r0i_A327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 1e-10
2r0i_A327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 1e-08
1zmu_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 1e-10
1zmu_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 1e-08
1zmv_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 1e-10
1zmv_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 1e-08
3iec_A319 Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K 1e-10
3iec_A319 Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K 1e-08
2hw6_A307 Crystal Structure Of Mnk1 Catalytic Domain Length = 1e-10
2hw6_A307 Crystal Structure Of Mnk1 Catalytic Domain Length = 1e-08
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 2e-10
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 1e-09
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 5e-04
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 2e-10
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 6e-08
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 2e-05
2cn5_A329 Crystal Structure Of Human Chk2 In Complex With Adp 2e-10
2cn5_A329 Crystal Structure Of Human Chk2 In Complex With Adp 9e-07
2wzj_A327 Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 2e-10
2wzj_A327 Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 1e-08
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 2e-10
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 7e-08
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 2e-05
2bfy_A284 Complex Of Aurora-B With Incenp And Hesperidin. Len 2e-10
2bfy_A284 Complex Of Aurora-B With Incenp And Hesperidin. Len 2e-07
3cqu_A342 Crystal Structure Of Akt-1 Complexed With Substrate 2e-10
3cqu_A342 Crystal Structure Of Akt-1 Complexed With Substrate 3e-04
2ycr_A323 Crystal Structure Of Checkpoint Kinase 2 In Complex 2e-10
2ycr_A323 Crystal Structure Of Checkpoint Kinase 2 In Complex 1e-06
3r1n_A317 Mk3 Kinase Bound To Compound 5b Length = 317 2e-10
3r1n_A317 Mk3 Kinase Bound To Compound 5b Length = 317 2e-06
3ocb_A341 Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor 2e-10
3ocb_A341 Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor 2e-04
2ycf_A322 Crystal Structure Of Checkpoint Kinase 2 In Complex 2e-10
2ycf_A322 Crystal Structure Of Checkpoint Kinase 2 In Complex 1e-06
3fhr_A336 High Resolution Crystal Structure Of Mitogen-Activa 2e-10
3fhr_A336 High Resolution Crystal Structure Of Mitogen-Activa 2e-06
2xk9_A322 Structural Analysis Of Checkpoint Kinase 2 (Chk2) I 2e-10
2xk9_A322 Structural Analysis Of Checkpoint Kinase 2 (Chk2) I 1e-06
3is5_A285 Crystal Structure Of Cdpk Kinase Domain From Toxopl 3e-10
3is5_A285 Crystal Structure Of Cdpk Kinase Domain From Toxopl 3e-09
3is5_A285 Crystal Structure Of Cdpk Kinase Domain From Toxopl 2e-08
2w0j_A323 Crystal Structure Of Chk2 In Complex With Nsc 10955 3e-10
2w0j_A323 Crystal Structure Of Chk2 In Complex With Nsc 10955 1e-06
4gv1_A340 Pkb Alpha In Complex With Azd5363 Length = 340 3e-10
4gv1_A340 Pkb Alpha In Complex With Azd5363 Length = 340 3e-04
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 3e-10
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 1e-08
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 2e-05
2hak_A328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 3e-10
2hak_A328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 3e-10
2hak_A328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 8e-07
1zmw_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 3e-10
1zmw_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 1e-08
2uv2_A287 Crystal Structure Of Human Ste20-Like Kinase Bound 3e-10
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 3e-10
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 1e-08
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 1e-05
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 3e-10
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 1e-08
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 2e-05
2qur_A350 Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe 3e-10
2qur_A350 Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe 3e-05
1j3h_A350 Crystal Structure Of Apoenzyme Camp-Dependent Prote 3e-10
1j3h_A350 Crystal Structure Of Apoenzyme Camp-Dependent Prote 3e-05
3fhi_A350 Crystal Structure Of A Complex Between The Catalyti 3e-10
3fhi_A350 Crystal Structure Of A Complex Between The Catalyti 3e-05
1rdq_E350 Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of 3e-10
1rdq_E350 Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of 1e-04
2erz_E351 Crystal Structure Of C-amp Dependent Kinase (pka) B 3e-10
2erz_E351 Crystal Structure Of C-amp Dependent Kinase (pka) B 3e-05
1jbp_E350 Crystal Structure Of The Catalytic Subunit Of Camp- 3e-10
1jbp_E350 Crystal Structure Of The Catalytic Subunit Of Camp- 3e-05
1fmo_E350 Crystal Structure Of A Polyhistidine-Tagged Recombi 4e-10
1fmo_E350 Crystal Structure Of A Polyhistidine-Tagged Recombi 3e-05
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 4e-10
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 3e-09
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 5e-04
1syk_A350 Crystal Structure Of E230q Mutant Of Camp-Dependent 4e-10
1syk_A350 Crystal Structure Of E230q Mutant Of Camp-Dependent 3e-05
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 4e-10
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 1e-08
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 2e-05
3qam_E350 Crystal Structure Of Glu208ala Mutant Of Catalytic 4e-10
3qam_E350 Crystal Structure Of Glu208ala Mutant Of Catalytic 1e-04
3qal_E350 Crystal Structure Of Arg280ala Mutant Of Catalytic 4e-10
3qal_E350 Crystal Structure Of Arg280ala Mutant Of Catalytic 3e-05
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 4e-10
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 1e-08
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 1e-05
1bkx_A350 A Binary Complex Of The Catalytic Subunit Of Camp-D 4e-10
1bkx_A350 A Binary Complex Of The Catalytic Subunit Of Camp-D 3e-05
2gu8_A337 Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel 4e-10
2gu8_A337 Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel 3e-05
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 4e-10
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 1e-08
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 1e-05
2ac3_A316 Structure Of Human Mnk2 Kinase Domain Length = 316 4e-10
2ac3_A316 Structure Of Human Mnk2 Kinase Domain Length = 316 2e-08
3uc3_A361 The Crystal Structure Of Snf1-Related Kinase 2.3 Le 5e-10
3uc3_A361 The Crystal Structure Of Snf1-Related Kinase 2.3 Le 4e-08
3uc3_A361 The Crystal Structure Of Snf1-Related Kinase 2.3 Le 2e-05
1apm_E350 2.0 Angstrom Refined Crystal Structure Of The Catal 5e-10
1apm_E350 2.0 Angstrom Refined Crystal Structure Of The Catal 3e-05
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 5e-10
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 9e-09
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 2e-05
3i6u_A419 Structure And Activation Mechanism Of The Chk2 Dna- 5e-10
3i6u_A419 Structure And Activation Mechanism Of The Chk2 Dna- 9e-07
4dfy_A371 Crystal Structure Of R194a Mutant Of Camp-Dependent 5e-10
4dfy_A371 Crystal Structure Of R194a Mutant Of Camp-Dependent 2e-05
3pvb_A345 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 5e-10
3pvb_A345 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 3e-05
1xjd_A345 Crystal Structure Of Pkc-Theta Complexed With Staur 5e-10
1xjd_A345 Crystal Structure Of Pkc-Theta Complexed With Staur 6e-06
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 5e-10
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 1e-08
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 1e-05
1omw_A689 Crystal Structure Of The Complex Between G Protein- 6e-10
3psc_A695 Bovine Grk2 In Complex With Gbetagamma Subunits Len 6e-10
1l3r_E350 Crystal Structure Of A Transition State Mimic Of Th 6e-10
1l3r_E350 Crystal Structure Of A Transition State Mimic Of Th 3e-05
3krw_A688 Human Grk2 In Complex With Gbetgamma Subunits And B 6e-10
3krw_A688 Human Grk2 In Complex With Gbetgamma Subunits And B 9e-04
3cik_A689 Human Grk2 In Complex With Gbetagamma Subunits Leng 6e-10
3cik_A689 Human Grk2 In Complex With Gbetagamma Subunits Leng 9e-04
3uc4_A362 The Crystal Structure Of Snf1-Related Kinase 2.6 Le 6e-10
3uc4_A362 The Crystal Structure Of Snf1-Related Kinase 2.6 Le 2e-07
3uc4_A362 The Crystal Structure Of Snf1-Related Kinase 2.6 Le 4e-05
3o7l_B350 Crystal Structure Of Phospholamban (1-19):pka C-Sub 6e-10
3o7l_B350 Crystal Structure Of Phospholamban (1-19):pka C-Sub 2e-05
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 6e-10
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 2e-08
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 1e-05
2qcs_A350 A Complex Structure Between The Catalytic And Regul 6e-10
2qcs_A350 A Complex Structure Between The Catalytic And Regul 3e-05
3i6w_A443 Structure And Activation Mechanism Of The Chk2 Dna- 6e-10
3i6w_A443 Structure And Activation Mechanism Of The Chk2 Dna- 9e-07
4dfx_E350 Crystal Structure Of Myristoylated K7c Catalytic Su 7e-10
4dfx_E350 Crystal Structure Of Myristoylated K7c Catalytic Su 4e-05
3udb_A317 Crystal Structure Of Snrk2.6 Length = 317 7e-10
3udb_A317 Crystal Structure Of Snrk2.6 Length = 317 6e-06
3udb_A317 Crystal Structure Of Snrk2.6 Length = 317 7e-05
3iw4_A360 Crystal Structure Of Pkc Alpha In Complex With Nvp- 7e-10
3iw4_A360 Crystal Structure Of Pkc Alpha In Complex With Nvp- 2e-05
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 9e-10
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 6e-08
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 2e-05
4dg3_E371 Crystal Structure Of R336a Mutant Of Camp-dependent 9e-10
4dg3_E371 Crystal Structure Of R336a Mutant Of Camp-dependent 3e-05
4fsu_A279 Crystal Structure Of The Chk1 Length = 279 9e-10
4fsu_A279 Crystal Structure Of The Chk1 Length = 279 3e-04
1y8g_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 1e-09
1y8g_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 6e-08
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 1e-09
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 5e-08
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 2e-05
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 1e-09
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 5e-08
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 1e-05
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 1e-09
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 4e-08
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 2e-05
2jed_A352 The Crystal Structure Of The Kinase Domain Of The P 1e-09
2jed_A352 The Crystal Structure Of The Kinase Domain Of The P 7e-06
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 1e-09
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 5e-08
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 1e-05
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 1e-09
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 5e-08
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 1e-05
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 1e-09
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 5e-08
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 1e-05
3ujg_A361 Crystal Structure Of Snrk2.6 In Complex With Hab1 L 1e-09
3ujg_A361 Crystal Structure Of Snrk2.6 In Complex With Hab1 L 1e-07
3ujg_A361 Crystal Structure Of Snrk2.6 In Complex With Hab1 L 4e-05
4fsz_A279 Crystal Structure Of The Chk1 Length = 279 1e-09
4fsz_A279 Crystal Structure Of The Chk1 Length = 279 2e-04
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 1e-09
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 4e-08
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 1e-05
4fsy_A279 Crystal Structure Of The Chk1 Length = 279 1e-09
4fsy_A279 Crystal Structure Of The Chk1 Length = 279 3e-04
1h1w_A289 High Resolution Crystal Structure Of The Human Pdk1 1e-09
1h1w_A289 High Resolution Crystal Structure Of The Human Pdk1 5e-08
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 1e-09
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 4e-08
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 1e-05
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 1e-09
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 6e-08
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 1e-05
1uu9_A286 Structure Of Human Pdk1 Kinase Domain In Complex Wi 1e-09
1uu9_A286 Structure Of Human Pdk1 Kinase Domain In Complex Wi 4e-08
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 2e-09
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 4e-08
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 1e-05
2y94_A476 Structure Of An Active Form Of Mammalian Ampk Lengt 2e-09
2y94_A476 Structure Of An Active Form Of Mammalian Ampk Lengt 2e-08
2y94_A 476 Structure Of An Active Form Of Mammalian Ampk Lengt 3e-04
2ydj_A276 Discovery Of Checkpoint Kinase Inhibitor Azd7762 By 2e-09
2ydj_A276 Discovery Of Checkpoint Kinase Inhibitor Azd7762 By 2e-04
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 2e-09
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 1e-08
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 1e-05
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 2e-09
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 6e-08
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 1e-05
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 2e-09
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 6e-08
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 1e-05
4ft3_A279 Crystal Structure Of The Chk1 Length = 279 2e-09
4ft3_A279 Crystal Structure Of The Chk1 Length = 279 2e-04
4fsw_A279 Crystal Structure Of The Chk1 Length = 279 2e-09
4fsw_A279 Crystal Structure Of The Chk1 Length = 279 2e-04
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 2e-09
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 5e-08
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 1e-05
1z5m_A286 Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr 2e-09
1z5m_A286 Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr 4e-08
3nus_A286 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra 2e-09
3nus_A286 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra 4e-08
2wnt_A330 Crystal Structure Of The Human Ribosomal Protein S6 2e-09
2wnt_A330 Crystal Structure Of The Human Ribosomal Protein S6 3e-08
4fsm_A279 Crystal Structure Of The Chk1 Length = 279 2e-09
4fsm_A279 Crystal Structure Of The Chk1 Length = 279 3e-04
4fsn_A278 Crystal Structure Of The Chk1 Length = 278 2e-09
4fsn_A278 Crystal Structure Of The Chk1 Length = 278 3e-04
2x8e_A276 Discovery Of A Novel Class Of Triazolones As Checkp 2e-09
2x8e_A276 Discovery Of A Novel Class Of Triazolones As Checkp 3e-04
3rny_A346 Crystal Structure Of Human Rsk1 C-Terminal Kinase D 2e-09
3rny_A346 Crystal Structure Of Human Rsk1 C-Terminal Kinase D 3e-08
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 2e-09
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 1e-07
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 1e-05
2h6d_A276 Protein Kinase Domain Of The Human 5'-Amp-Activated 2e-09
2h6d_A276 Protein Kinase Domain Of The Human 5'-Amp-Activated 2e-08
2h6d_A276 Protein Kinase Domain Of The Human 5'-Amp-Activated 6e-06
2j7t_A302 Crystal Structure Of Human Serine Threonine Kinase- 2e-09
4fst_A269 Crystal Structure Of The Chk1 Length = 269 2e-09
4fst_A269 Crystal Structure Of The Chk1 Length = 269 3e-04
2ghg_A269 H-Chk1 Complexed With A431994 Length = 269 2e-09
2ghg_A269 H-Chk1 Complexed With A431994 Length = 269 3e-04
4bc6_A293 Crystal Structure Of Human Serine Threonine Kinase- 2e-09
2yza_A276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 2e-09
2yza_A276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 2e-08
2yza_A276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 6e-06
2e9v_A268 Structure Of H-Chk1 Complexed With A859017 Length = 2e-09
2e9v_A268 Structure Of H-Chk1 Complexed With A859017 Length = 3e-04
2br1_A297 Structure-Based Design Of Novel Chk1 Inhibitors: In 2e-09
2br1_A297 Structure-Based Design Of Novel Chk1 Inhibitors: In 3e-04
1ia8_A289 The 1.7 A Crystal Structure Of Human Cell Cycle Che 2e-09
1ia8_A289 The 1.7 A Crystal Structure Of Human Cell Cycle Che 3e-04
1zlt_A295 Crystal Structure Of Chk1 Complexed With A Hymenald 2e-09
1zlt_A295 Crystal Structure Of Chk1 Complexed With A Hymenald 3e-04
2hog_A322 Crystal Structure Of Chek1 In Complex With Inhibito 2e-09
2hog_A322 Crystal Structure Of Chek1 In Complex With Inhibito 4e-04
2r0u_A323 Crystal Structure Of Chek1 In Complex With Inhibito 2e-09
2r0u_A323 Crystal Structure Of Chek1 In Complex With Inhibito 3e-04
3ot3_A273 X-Ray Crystal Structure Of Compound 22k Bound To Hu 2e-09
3ot3_A273 X-Ray Crystal Structure Of Compound 22k Bound To Hu 3e-04
3jvr_A271 Characterization Of The Chk1 Allosteric Inhibitor B 2e-09
3jvr_A271 Characterization Of The Chk1 Allosteric Inhibitor B 3e-04
3mn3_A271 An Inhibited Conformation For The Protein Kinase Do 2e-09
3mn3_A271 An Inhibited Conformation For The Protein Kinase Do 9e-09
2ayp_A269 Crystal Structure Of Chk1 With An Indol Inhibitor L 3e-09
2ayp_A269 Crystal Structure Of Chk1 With An Indol Inhibitor L 4e-04
2i0e_A353 Structure Of Catalytic Domain Of Human Protein Kina 3e-09
2i0e_A353 Structure Of Catalytic Domain Of Human Protein Kina 3e-06
3h9o_A311 Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) 3e-09
3h9o_A311 Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) 3e-08
3l9m_A351 Crystal Structure Of Pkab3 (Pka Triple Mutant V123a 3e-09
3l9m_A351 Crystal Structure Of Pkab3 (Pka Triple Mutant V123a 4e-05
2fh9_A274 Structure And Dimerization Of The Kinase Domain Fro 3e-09
2fh9_A274 Structure And Dimerization Of The Kinase Domain Fro 1e-08
3dae_A283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 3e-09
3dae_A283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 9e-09
2r7b_A312 Crystal Structure Of The Phosphoinositide-Dependent 3e-09
2r7b_A312 Crystal Structure Of The Phosphoinositide-Dependent 3e-08
3iop_A312 Pdk-1 In Complex With The Inhibitor Compound-8i Len 3e-09
3iop_A312 Pdk-1 In Complex With The Inhibitor Compound-8i Len 4e-08
3hyh_A275 Crystal Structure Of The Protein Kinase Domain Of Y 3e-09
3hyh_A275 Crystal Structure Of The Protein Kinase Domain Of Y 9e-09
2biy_A310 Structure Of Pdk1-S241a Mutant Kinase Domain Length 3e-09
2biy_A310 Structure Of Pdk1-S241a Mutant Kinase Domain Length 4e-08
2clq_A295 Structure Of Mitogen-Activated Protein Kinase Kinas 3e-09
1uu3_A310 Structure Of Human Pdk1 Kinase Domain In Complex Wi 3e-09
1uu3_A310 Structure Of Human Pdk1 Kinase Domain In Complex Wi 4e-08
2xch_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 3e-09
2xch_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 4e-08
3nun_A292 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea 3e-09
3nun_A292 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea 4e-08
3sc1_A311 Novel Isoquinolone Pdk1 Inhibitors Discovered Throu 4e-09
3sc1_A311 Novel Isoquinolone Pdk1 Inhibitors Discovered Throu 4e-08
3rwp_A311 Discovery Of A Novel, Potent And Selective Inhibito 4e-09
3rwp_A311 Discovery Of A Novel, Potent And Selective Inhibito 4e-08
3pfq_A674 Crystal Structure And Allosteric Activation Of Prot 4e-09
3pfq_A674 Crystal Structure And Allosteric Activation Of Prot 2e-06
1zys_A273 Co-Crystal Structure Of Checkpoint Kinase Chk1 With 4e-09
1zys_A273 Co-Crystal Structure Of Checkpoint Kinase Chk1 With 4e-04
1smh_A350 Protein Kinase A Variant Complex With Completely Or 4e-09
1smh_A350 Protein Kinase A Variant Complex With Completely Or 2e-05
3orx_A316 Pdk1 Mutant Bound To Allosteric Disulfide Fragment 4e-09
3orx_A316 Pdk1 Mutant Bound To Allosteric Disulfide Fragment 4e-08
4a07_A311 Human Pdk1 Kinase Domain In Complex With Allosteric 4e-09
4a07_A311 Human Pdk1 Kinase Domain In Complex With Allosteric 1e-07
1xh9_A350 Crystal Structures Of Protein Kinase B Selective In 4e-09
1xh9_A350 Crystal Structures Of Protein Kinase B Selective In 3e-05
3nay_A311 Pdk1 In Complex With Inhibitor Mp6 Length = 311 4e-09
3nay_A311 Pdk1 In Complex With Inhibitor Mp6 Length = 311 4e-08
3hrc_A311 Crystal Structure Of A Mutant Of Human Pdk1 Kinase 4e-09
3hrc_A311 Crystal Structure Of A Mutant Of Human Pdk1 Kinase 1e-07
3qc4_A314 Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 4e-09
3qc4_A314 Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 4e-08
3nax_A311 Pdk1 In Complex With Inhibitor Mp7 Length = 311 4e-09
3nax_A311 Pdk1 In Complex With Inhibitor Mp7 Length = 311 3e-08
3a60_A327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 4e-09
3a60_A327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 1e-08
3h4j_B336 Crystal Structure Of Pombe Ampk Kdaid Fragment Leng 4e-09
3h4j_B336 Crystal Structure Of Pombe Ampk Kdaid Fragment Leng 3e-04
3a62_A327 Crystal Structure Of Phosphorylated P70s6k1 Length 5e-09
3a62_A327 Crystal Structure Of Phosphorylated P70s6k1 Length 1e-08
4ae6_A343 Structure And Function Of The Human Sperm-specific 5e-09
4ae6_A343 Structure And Function Of The Human Sperm-specific 3e-05
3agl_A351 Complex Of Pka With The Bisubstrate Protein Kinase 5e-09
3agl_A351 Complex Of Pka With The Bisubstrate Protein Kinase 3e-05
3agm_A351 Complex Of Pka With The Bisubstrate Protein Kinase 5e-09
3agm_A351 Complex Of Pka With The Bisubstrate Protein Kinase 3e-05
3vw6_A269 Crystal Structure Of Human Apoptosis Signal-Regulat 5e-09
3vw6_A269 Crystal Structure Of Human Apoptosis Signal-Regulat 3e-08
3nx8_A351 Human Camp Dependent Protein Kinase In Complex With 5e-09
3nx8_A351 Human Camp Dependent Protein Kinase In Complex With 3e-05
1ydt_E350 Structure Of Camp-Dependent Protein Kinase, Alpha-C 7e-09
1ydt_E350 Structure Of Camp-Dependent Protein Kinase, Alpha-C 3e-05
1fot_A318 Structure Of The Unliganded Camp-Dependent Protein 7e-09
1q24_A350 Pka Double Mutant Model Of Pkb In Complex With Mgat 7e-09
1q24_A350 Pka Double Mutant Model Of Pkb In Complex With Mgat 3e-05
3zut_A362 The Structure Of Ost1 (D160a) Kinase Length = 362 7e-09
3zut_A362 The Structure Of Ost1 (D160a) Kinase Length = 362 2e-06
3zut_A362 The Structure Of Ost1 (D160a) Kinase Length = 362 5e-05
3zuu_A362 The Structure Of Ost1 (D160a, S175d) Kinase In Comp 7e-09
3zuu_A362 The Structure Of Ost1 (D160a, S175d) Kinase In Comp 1e-06
3zuu_A362 The Structure Of Ost1 (D160a, S175d) Kinase In Comp 5e-05
3mvj_A371 Human Cyclic Amp-Dependent Protein Kinase Pka Inhib 8e-09
3mvj_A371 Human Cyclic Amp-Dependent Protein Kinase Pka Inhib 3e-05
3cok_A278 Crystal Structure Of Plk4 Kinase Length = 278 8e-09
3cok_A278 Crystal Structure Of Plk4 Kinase Length = 278 2e-08
1q61_A350 Pka Triple Mutant Model Of Pkb Length = 350 8e-09
1q61_A350 Pka Triple Mutant Model Of Pkb Length = 350 5e-05
4ae9_A343 Structure And Function Of The Human Sperm-specific 8e-09
4ae9_A343 Structure And Function Of The Human Sperm-specific 3e-05
2vwi_A303 Structure Of The Osr1 Kinase, A Hypertension Drug T 1e-08
2vwi_A303 Structure Of The Osr1 Kinase, A Hypertension Drug T 4e-06
2xck_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 1e-08
2xck_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 3e-08
3dak_A290 Crystal Structure Of Domain-Swapped Osr1 Kinase Dom 1e-08
3dak_A290 Crystal Structure Of Domain-Swapped Osr1 Kinase Dom 5e-06
1ctp_E350 Structure Of The Mammalian Catalytic Subunit Of Cam 1e-08
1ctp_E350 Structure Of The Mammalian Catalytic Subunit Of Cam 3e-05
2uzt_A336 Pka Structures Of Akt, Indazole-Pyridine Inhibitors 1e-08
2uzt_A336 Pka Structures Of Akt, Indazole-Pyridine Inhibitors 2e-05
1cdk_A350 Camp-Dependent Protein Kinase Catalytic Subunit (E. 1e-08
1cdk_A350 Camp-Dependent Protein Kinase Catalytic Subunit (E. 3e-05
3nyn_A576 Crystal Structure Of G Protein-Coupled Receptor Kin 1e-08
3nyn_A576 Crystal Structure Of G Protein-Coupled Receptor Kin 2e-04
1szm_A350 Dual Binding Mode Of Bisindolylmaleimide 2 To Prote 1e-08
1szm_A350 Dual Binding Mode Of Bisindolylmaleimide 2 To Prote 5e-05
2c1a_A351 Structure Of Camp-Dependent Protein Kinase Complexe 1e-08
2c1a_A351 Structure Of Camp-Dependent Protein Kinase Complexe 3e-05
1svh_A350 Crystal Structure Of Protein Kinase A In Complex Wi 1e-08
1svh_A350 Crystal Structure Of Protein Kinase A In Complex Wi 3e-05
2f7e_E351 Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu 1e-08
2f7e_E351 Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu 2e-05
1stc_E350 Camp-Dependent Protein Kinase, Alpha-Catalytic Subu 1e-08
1stc_E350 Camp-Dependent Protein Kinase, Alpha-Catalytic Subu 3e-05
3dnd_A350 Camp-Dependent Protein Kinase Pka Catalytic Subunit 1e-08
3dnd_A350 Camp-Dependent Protein Kinase Pka Catalytic Subunit 3e-05
2acx_A576 Crystal Structure Of G Protein Coupled Receptor Kin 1e-08
2acx_A576 Crystal Structure Of G Protein Coupled Receptor Kin 1e-04
1cmk_E350 Crystal Structures Of The Myristylated Catalytic Su 1e-08
1cmk_E350 Crystal Structures Of The Myristylated Catalytic Su 3e-05
4aw2_A437 Crystal Structure Of Cdc42 Binding Protein Kinase A 2e-08
3ama_A351 Protein Kinase A Sixfold Mutant Model Of Aurora B W 2e-08
3ama_A351 Protein Kinase A Sixfold Mutant Model Of Aurora B W 5e-05
2pk9_A317 Structure Of The Pho85-pho80 Cdk-cyclin Complex Of 2e-08
1vzo_A355 The Structure Of The N-Terminal Kinase Domain Of Ms 2e-08
1vzo_A355 The Structure Of The N-Terminal Kinase Domain Of Ms 3e-05
1vzo_A355 The Structure Of The N-Terminal Kinase Domain Of Ms 8e-05
1xh7_A350 Crystal Structures Of Protein Kinase B Selective In 2e-08
1xh7_A350 Crystal Structures Of Protein Kinase B Selective In 3e-05
1q8w_A350 The Catalytic Subunit Of Camp-Dependent Protein Kin 2e-08
1q8w_A350 The Catalytic Subunit Of Camp-Dependent Protein Kin 3e-05
2jds_A351 Structure Of Camp-Dependent Protein Kinase Complexe 2e-08
2jds_A351 Structure Of Camp-Dependent Protein Kinase Complexe 3e-05
3pwy_A311 Crystal Structure Of An Extender (Spd28345)-Modifie 2e-08
3pwy_A311 Crystal Structure Of An Extender (Spd28345)-Modifie 3e-08
2jdt_A351 Structure Of Pka-Pkb Chimera Complexed With Isoquin 3e-08
2jdt_A351 Structure Of Pka-Pkb Chimera Complexed With Isoquin 4e-05
2vo0_A351 Structure Of Pka-Pkb Chimera Complexed With C-(4-(4 3e-08
2vo0_A351 Structure Of Pka-Pkb Chimera Complexed With C-(4-(4 4e-05
2vd5_A412 Structure Of Human Myotonic Dystrophy Protein Kinas 3e-08
2vd5_A412 Structure Of Human Myotonic Dystrophy Protein Kinas 1e-07
3ggf_A301 Crystal Structure Of Human SerineTHREONINE-Protein 3e-08
3ggf_A301 Crystal Structure Of Human SerineTHREONINE-Protein 6e-05
2uvy_A351 Structure Of Pka-pkb Chimera Complexed With Methyl- 5e-08
2uvy_A351 Structure Of Pka-pkb Chimera Complexed With Methyl- 4e-05
1uv5_A350 Glycogen Synthase Kinase 3 Beta Complexed With 6-Br 5e-08
1uv5_A350 Glycogen Synthase Kinase 3 Beta Complexed With 6-Br 4e-04
1h8f_A352 Glycogen Synthase Kinase 3 Beta. Length = 352 6e-08
1h8f_A352 Glycogen Synthase Kinase 3 Beta. Length = 352 5e-04
3tku_A433 Mrck Beta In Complex With Fasudil Length = 433 6e-08
3qfv_A415 Mrck Beta In Complex With Tpca-1 Length = 415 6e-08
1v0o_A288 Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho 7e-08
1ob3_A288 Structure Of P. Falciparum Pfpk5 Length = 288 7e-08
1v0b_A288 Crystal Structure Of The T198a Mutant Of Pfpk5 Leng 7e-08
3v8s_A410 Human Rho-Associated Protein Kinase 1 (Rock 1) In C 9e-08
2gnj_A350 Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 9e-08
2gnj_A350 Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 5e-05
2esm_A415 Crystal Structure Of Rock 1 Bound To Fasudil Length 9e-08
3txo_A353 Pkc Eta Kinase In Complex With A Naphthyridine Leng 9e-08
2v55_A406 Mechanism Of Multi-site Phosphorylation From A Rock 9e-08
1h4l_A292 Structure And Regulation Of The Cdk5-P25(Nck5a) Com 1e-07
1vyw_A309 Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 1e-07
4ec8_A373 Structure Of Full Length Cdk9 In Complex With Cycli 1e-07
2zv2_A298 Crystal Structure Of Human CalciumCALMODULIN-Depend 2e-07
2zv2_A298 Crystal Structure Of Human CalciumCALMODULIN-Depend 1e-06
4ic7_A442 Crystal Structure Of The Erk5 Kinase Domain In Comp 2e-07
1zrz_A364 Crystal Structure Of The Catalytic Domain Of Atypic 2e-07
3mi9_A351 Crystal Structure Of Hiv-1 Tat Complexed With Human 2e-07
3a8w_A345 Crystal Structure Of Pkciota Kinase Domain Length = 2e-07
2wtk_C305 Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo2 2e-07
3zh8_A349 A Novel Small Molecule Apkc Inhibitor Length = 349 2e-07
4bcf_A331 Structure Of Cdk9 In Complex With Cyclin T And A 2- 2e-07
4b99_A398 Crystal Structure Of Mapk7 (Erk5) With Inhibitor Le 2e-07
1o9u_A350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 3e-07
1o9u_A350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 6e-04
3blh_A331 Crystal Structure Of Human Cdk9CYCLINT1 Length = 33 3e-07
4af3_A292 Human Aurora B Kinase In Complex With Incenp And Vx 3e-07
4af3_A292 Human Aurora B Kinase In Complex With Incenp And Vx 6e-05
4dc2_A396 Structure Of Pkc In Complex With A Substrate Peptid 3e-07
2wqm_A310 Structure Of Apo Human Nek7 Length = 310 3e-07
2wqm_A310 Structure Of Apo Human Nek7 Length = 310 3e-05
2gnf_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 3e-07
2gnf_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 4e-05
2gng_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 3e-07
2gng_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 5e-05
1ung_A292 Structural Mechanism For The Inhibition Of Cdk5-P25 4e-07
3fpq_A290 Crystal Structure Of The Kinase Domain Of Wnk1 Leng 4e-07
3say_A430 Crystal Structure Of Human Glycogen Synthase Kinase 4e-07
3say_A430 Crystal Structure Of Human Glycogen Synthase Kinase 4e-04
4afj_A367 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selec 4e-07
4afj_A367 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selec 4e-04
2xik_A294 Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K 4e-07
2xik_A294 Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K 2e-04
1gng_A378 Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With 4e-07
1gng_A378 Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With 4e-04
4dit_A382 Crystal Structure Of Gsk3beta In Complex With A Imi 4e-07
4dit_A382 Crystal Structure Of Gsk3beta In Complex With A Imi 4e-04
1q5k_A414 Crystal Structure Of Glycogen Synthase Kinase 3 In 4e-07
1q5k_A414 Crystal Structure Of Glycogen Synthase Kinase 3 In 3e-04
1i09_A420 Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Len 4e-07
1i09_A420 Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Len 4e-04
2ow3_A352 Glycogen Synthase Kinase-3 Beta In Complex With Bis 4e-07
2ow3_A352 Glycogen Synthase Kinase-3 Beta In Complex With Bis 5e-04
2o5k_A372 Crystal Structure Of Gsk3beta In Complex With A Ben 5e-07
2o5k_A372 Crystal Structure Of Gsk3beta In Complex With A Ben 4e-04
3zdi_A350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 5e-07
3zdi_A350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 5e-04
3sd0_A350 Identification Of A Glycogen Synthase Kinase-3b Inh 5e-07
3sd0_A350 Identification Of A Glycogen Synthase Kinase-3b Inh 4e-04
3f7z_A350 X-ray Co-crystal Structure Of Glycogen Synthase Kin 5e-07
3f7z_A350 X-ray Co-crystal Structure Of Glycogen Synthase Kin 5e-04
2iw6_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com 5e-07
1oit_A299 Imidazopyridines: A Potent And Selective Class Of C 5e-07
4eoj_A302 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 5e-07
1pyx_A422 Gsk-3 Beta Complexed With Amp-Pnp Length = 422 5e-07
1pyx_A422 Gsk-3 Beta Complexed With Amp-Pnp Length = 422 4e-04
3zrk_A371 Identification Of 2-(4-Pyridyl)thienopyridinones As 5e-07
3zrk_A371 Identification Of 2-(4-Pyridyl)thienopyridinones As 4e-04
4eom_A301 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 5e-07
1ua2_A346 Crystal Structure Of Human Cdk7 Length = 346 5e-07
3thb_A333 Structure Of Plk1 Kinase Domain In Complex With A B 5e-07
3thb_A333 Structure Of Plk1 Kinase Domain In Complex With A B 3e-06
3mtl_A324 Crystal Structure Of The Pctaire1 Kinase In Complex 5e-07
2v5q_A315 Crystal Structure Of Wild-type Plk-1 Kinase Domain 5e-07
2v5q_A315 Crystal Structure Of Wild-type Plk-1 Kinase Domain 4e-06
4eon_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 6e-07
1q3d_A424 Gsk-3 Beta Complexed With Staurosporine Length = 42 6e-07
1q3d_A424 Gsk-3 Beta Complexed With Staurosporine Length = 42 4e-04
2ou7_A335 Structure Of The Catalytic Domain Of Human Polo-Lik 6e-07
2ou7_A335 Structure Of The Catalytic Domain Of Human Polo-Lik 4e-06
4eok_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 6e-07
3f88_A349 Glycogen Synthase Kinase 3beta Inhibitor Complex Le 6e-07
3f88_A349 Glycogen Synthase Kinase 3beta Inhibitor Complex Le 5e-04
1r0e_A391 Glycogen Synthase Kinase-3 Beta In Complex With 3-I 6e-07
1r0e_A391 Glycogen Synthase Kinase-3 Beta In Complex With 3-I 4e-04
3gb2_A353 Gsk3beta Inhibitor Complex Length = 353 6e-07
3gb2_A353 Gsk3beta Inhibitor Complex Length = 353 5e-04
1pf8_A298 Crystal Structure Of Human Cyclin-dependent Kinase 6e-07
4i3z_A296 Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES 6e-07
1w98_A298 The Structural Basis Of Cdk2 Activation By Cyclin E 6e-07
4eoq_A301 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 7e-07
4bcq_A301 Structure Of Cdk2 In Complex With Cyclin A And A 2- 7e-07
4eos_A300 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 7e-07
1e9h_A297 Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex 7e-07
2yac_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 7e-07
2yac_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 3e-06
1gz8_A299 Human Cyclin Dependent Kinase 2 Complexed With The 7e-07
1jst_A298 Phosphorylated Cyclin-Dependent Kinase-2 Bound To C 7e-07
4erw_A306 Cdk2 In Complex With Staurosporine Length = 306 7e-07
3kb7_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 7e-07
3kb7_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 4e-06
2w17_A299 Cdk2 In Complex With The Imidazole Pyrimidine Amide 7e-07
1fin_A298 Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 7e-07
1qmz_A299 Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com 7e-07
4acc_A465 Gsk3b In Complex With Inhibitor Length = 465 7e-07
4acc_A465 Gsk3b In Complex With Inhibitor Length = 465 4e-04
4eop_A300 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 7e-07
3pj8_A299 Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] 7e-07
3ezr_A300 Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ 7e-07
3bht_A300 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 7e-07
3pxf_A306 Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N 7e-07
1ogu_A302 Structure Of Human Thr160-phospho Cdk2/cyclin A Com 7e-07
1cm8_A367 Phosphorylated Map Kinase P38-Gamma Length = 367 7e-07
1cm8_A367 Phosphorylated Map Kinase P38-Gamma Length = 367 4e-05
3zgw_A347 Crystal Structure Of Maternal Embryonic Leucine Zip 8e-07
3zgw_A347 Crystal Structure Of Maternal Embryonic Leucine Zip 2e-05
2rku_A294 Structure Of Plk1 In Complex With Bi2536 Length = 2 8e-07
2rku_A294 Structure Of Plk1 In Complex With Bi2536 Length = 2 2e-06
3qhr_A298 Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic 8e-07
2jgz_A289 Crystal Structure Of Phospho-Cdk2 In Complex With C 8e-07
1h1p_A303 Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP 8e-07
3niz_A311 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 9e-07
4eoo_A299 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 9e-07
4eoi_A299 Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc 9e-07
2qkr_A313 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 9e-07
1gii_A298 Human Cyclin Dependent Kinase 2 Complexed With The 9e-07
2iw8_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 1e-06
3e7o_A360 Crystal Structure Of Jnk2 Length = 360 1e-06
3e7o_A360 Crystal Structure Of Jnk2 Length = 360 8e-05
3a7f_A303 Human Mst3 Kinase Length = 303 1e-06
3a7f_A303 Human Mst3 Kinase Length = 303 2e-04
3ckx_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 1e-06
3ckx_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 2e-04
3ckw_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 1e-06
3ckw_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 8e-05
2b9h_A353 Crystal Structure Of Fus3 With A Docking Motif From 1e-06
2f9g_A353 Crystal Structure Of Fus3 Phosphorylated On Tyr182 1e-06
2b9f_A353 Crystal Structure Of Non-Phosphorylated Fus3 Length 1e-06
3kga_A299 Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexe 2e-06
2f2u_A402 Crystal Structure Of The Rho-Kinase Kinase Domain L 2e-06
4gs6_A315 Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz 2e-06
3zhp_C294 Human Mst3 (stk24) In Complex With Mo25beta Length 2e-06
3zhp_C294 Human Mst3 (stk24) In Complex With Mo25beta Length 1e-04
4eqm_A294 Structural Analysis Of Staphylococcus Aureus Serine 2e-06
2eva_A307 Structural Basis For The Interaction Of Tak1 Kinase 2e-06
3npc_A364 Crystal Structure Of Jnk2 Complexed With Birb796 Le 2e-06
3npc_A364 Crystal Structure Of Jnk2 Complexed With Birb796 Le 1e-04
1oir_A299 Imidazopyridines: A Potent And Selective Class Of C 2e-06
1h01_A298 Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili 2e-06
3nie_A429 Crystal Structure Of Pf11_0147 Length = 429 3e-06
3s95_A310 Crystal Structure Of The Human Limk1 Kinase Domain 3e-06
3v3v_A379 Structural And Functional Analysis Of Quercetagetin 3e-06
3v3v_A379 Structural And Functional Analysis Of Quercetagetin 2e-04
2g01_A370 Pyrazoloquinolones As Novel, Selective Jnk1 Inhibit 3e-06
1q8y_A373 The Structure Of The Yeast Sr Protein Kinase, Sky1p 3e-06
1how_A373 The X-Ray Crystal Structure Of Sky1p, An Sr Protein 3e-06
3fi3_A364 Crystal Structure Of Jnk3 With Indazole Inhibitor, 3e-06
3o17_A370 Crystal Structure Of Jnk1-Alpha1 Isoform Length = 3 3e-06
2x7f_A326 Crystal Structure Of The Kinase Domain Of Human Tra 4e-06
2x7f_A326 Crystal Structure Of The Kinase Domain Of Human Tra 7e-06
4g3g_A350 Crystal Structure Of Murine Nf-kappab Inducing Kina 4e-06
4g3f_A336 Crystal Structure Of Murine Nf-kappab Inducing Kina 4e-06
4g3c_A352 Crystal Structure Of Apo Murine Nf-kappab Inducing 4e-06
3vuh_A370 Crystal Structure Of A Cysteine-deficient Mutant M3 4e-06
3vuh_A370 Crystal Structure Of A Cysteine-deficient Mutant M3 2e-04
2pzi_A 681 Crystal Structure Of Protein Kinase Pkng From Mycob 4e-06
3fv8_A355 Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Le 4e-06
3vui_A370 Crystal Structure Of A Cysteine-deficient Mutant M2 4e-06
3vui_A370 Crystal Structure Of A Cysteine-deficient Mutant M2 2e-04
3kvx_A364 Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Le 5e-06
3vum_A370 Crystal Structure Of A Cysteine-deficient Mutant M7 5e-06
3vum_A370 Crystal Structure Of A Cysteine-deficient Mutant M7 4e-05
3omv_A307 Crystal Structure Of C-Raf (Raf-1) Length = 307 5e-06
2r9s_A356 C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Qu 5e-06
3oxi_A362 Design And Synthesis Of Disubstituted Thiophene And 5e-06
2o0u_A364 Crystal Structure Of Human Jnk3 Complexed With N-{3 6e-06
1pmn_A364 Crystal Structure Of Jnk3 In Complex With An Imidaz 6e-06
3ptg_A363 Design And Synthesis Of A Novel, Orally Efficacious 6e-06
2ok1_A365 Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3 6e-06
4h36_A356 Crystal Structure Of Jnk3 In Complex With Atf2 Pept 6e-06
3db6_A301 Crystal Structure Of An Activated (Thr->asp) Polo-L 6e-06
2exc_X356 Inhibitor Complex Of Jnk3 Length = 356 6e-06
2b1p_A355 Inhibitor Complex Of Jnk3 Length = 355 6e-06
3vug_A370 Crystal Structure Of A Cysteine-deficient Mutant M2 7e-06
3vug_A370 Crystal Structure Of A Cysteine-deficient Mutant M2 2e-04
3vul_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 7e-06
3vul_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 5e-05
3vuk_A370 Crystal Structure Of A Cysteine-deficient Mutant M5 7e-06
3vuk_A370 Crystal Structure Of A Cysteine-deficient Mutant M5 2e-04
3fi2_A353 Crystal Structure Of Jnk3 With Amino-Pyrazole Inhib 7e-06
1jnk_A423 The C-Jun N-Terminal Kinase (Jnk3s) Complexed With 7e-06
3coi_A353 Crystal Structure Of P38delta Kinase Length = 353 8e-06
3coi_A353 Crystal Structure Of P38delta Kinase Length = 353 2e-05
3ttj_A464 Crystal Structure Of Jnk3 Complexed With Cc-359, A 8e-06
3pze_A358 Jnk1 In Complex With Inhibitor Length = 358 8e-06
3d5u_A317 Crystal Structure Of A Wildtype Polo-Like Kinase 1 8e-06
3d5w_A317 Crystal Structure Of A Phosphorylated Polo-Like Kin 8e-06
1ukh_A369 Structural Basis For The Selective Inhibition Of Jn 8e-06
1ukh_A369 Structural Basis For The Selective Inhibition Of Jn 3e-04
4exu_A371 Mapk13, Inactive Form Length = 371 9e-06
4exu_A371 Mapk13, Inactive Form Length = 371 2e-05
3d5v_A317 Crystal Structure Of An Activated (Thr->asp) Polo-L 9e-06
3vud_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 9e-06
3vud_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 2e-04
2xs0_A386 Linear Binding Motifs For Jnk And For Calcineurin A 9e-06
2xs0_A386 Linear Binding Motifs For Jnk And For Calcineurin A 2e-04
3elj_A369 Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine 9e-06
2pml_X348 Crystal Structure Of Pfpk7 In Complex With An Atp A 1e-05
2xrw_A371 Linear Binding Motifs For Jnk And For Calcineurin A 1e-05
2xrw_A371 Linear Binding Motifs For Jnk And For Calcineurin A 2e-04
2in6_A287 Wee1 Kinase Complex With Inhibitor Pd311839 Length 1e-05
2z2w_A285 Humand Wee1 Kinase Complexed With Inhibitor Pf03357 1e-05
3f69_A311 Crystal Structure Of The Mycobacterium Tuberculosis 1e-05
3bi6_A287 Wee1 Kinase Complex With Inhibitor Pd352396 Length 1e-05
1x8b_A289 Structure Of Human Wee1a Kinase: Kinase Domain Comp 1e-05
1pme_A380 Structure Of Penta Mutant Human Erk2 Map Kinase Com 1e-05
3c4c_A280 B-Raf Kinase In Complex With Plx4720 Length = 280 1e-05
4e7w_A394 Structure Of Gsk3 From Ustilago Maydis Length = 394 2e-05
4agu_A311 Crystal Structure Of The Human Cdkl1 Kinase Domain 2e-05
4fk3_A292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 2e-05
3f61_A311 Crystal Structure Of M. Tuberculosis Pknb Leu33aspV 2e-05
3oz6_A388 Crystal Structure Of Mapk From Cryptosporidium Parv 2e-05
1na7_A329 Crystal Structure Of The Catalytic Subunit Of Human 2e-05
1na7_A329 Crystal Structure Of The Catalytic Subunit Of Human 6e-04
3ori_A311 Mycobacterium Tuberculosis Pknb Kinase Domain L33d 2e-05
1o6y_A299 Catalytic Domain Of Pknb Kinase From Mycobacterium 2e-05
1mru_A311 Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycob 2e-05
3orm_A311 Mycobacterium Tuberculosis Pknb Kinase Domain D76a 2e-05
3d83_A360 Crystal Structure Of P38 Kinase In Complex With A B 3e-05
2baq_A365 P38alpha Bound To Ro3201195 Length = 365 3e-05
1uwj_A276 The Complex Of Mutant V599e B-raf And Bay439006 Len 3e-05
2puu_A348 Crystal Structure Of P38 Complex With 1-(5-Tert-But 3e-05
3idp_A300 B-Raf V600e Kinase Domain In Complex With An Aminoi 3e-05
1ywr_A360 Crystal Structure Analysis Of Inactive P38 Kinase D 3e-05
3q96_A282 B-Raf Kinase Domain In Complex With A Tetrahydronap 3e-05
3d7z_A360 Crystal Structure Of P38 Kinase In Complex With A B 4e-05
3ii5_A306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 4e-05
4h58_A275 Braf In Complex With Compound 3 Length = 275 4e-05
3gcp_A360 Human P38 Map Kinase In Complex With Sb203580 Lengt 4e-05
2fb8_A281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 4e-05
1yw2_A360 Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 4e-05
1lew_A360 Crystal Structure Of Map Kinase P38 Complexed To Th 4e-05
3p4k_A370 The Third Conformation Of P38a Map Kinase Observed 4e-05
4hzs_A341 Crystal Structure Of Ack1 Kinase Domain With C-term 4e-05
1u5q_A348 Crystal Structure Of The Tao2 Kinase Domain: Activa 4e-05
2gcd_A309 Tao2 Kinase Domain-Staurosporine Structure Length = 4e-05
4dbn_A284 Crystal Structure Of The Kinase Domain Of Human B-R 4e-05
3d4q_A307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 4e-05
2bal_A365 P38alpha Map Kinase Bound To Pyrazoloamine Length = 4e-05
4g9r_A307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 4e-05
2y8o_A362 Crystal Structure Of Human P38alpha Complexed With 4e-05
3eqp_B276 Crystal Structure Of Ack1 With Compound T95 Length 4e-05
1u54_A291 Crystal Structures Of The Phosphorylated And Unphos 4e-05
3t8o_A543 Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolu 5e-05
2ghl_A348 Mutant Mus Musculus P38 Kinase Domain In Complex Wi 5e-05
3odz_X360 Crystal Structure Of P38alpha Y323r Active Mutant L 5e-05
3c4x_A543 Crystal Structure Of G Protein Coupled Receptor Kin 5e-05
2gtm_A348 Mutated Mouse P38 Map Kinase Domain In Complex With 5e-05
2baj_A365 P38alpha Bound To Pyrazolourea Length = 365 5e-05
3fi4_A372 P38 Kinase Crystal Structure In Complex With Ro4499 5e-05
3hrb_A359 P38 Kinase Crystal Structure In Complex With Small 5e-05
3cd3_A377 Crystal Structure Of Phosphorylated Human Feline Sa 5e-05
3c4w_A543 Crystal Structure Of G Protein Coupled Receptor Kin 5e-05
1bmk_A379 The Complex Structure Of The Map Kinase P38SB218655 5e-05
1u46_A291 Crystal Structure Of The Unphosphorylated Kinase Do 5e-05
1ove_A366 The Structure Of P38 Alpha In Complex With A Dihydr 5e-05
4ewh_B275 Co-Crystal Structure Of Ack1 With Inhibitor Length 5e-05
3bkb_A377 Crystal Structure Of Human Feline Sarcoma Viral Onc 5e-05
3tg1_A380 Crystal Structure Of P38alpha In Complex With A Map 5e-05
2npq_A367 A Novel Lipid Binding Site In The P38 Alpha Map Kin 5e-05
3oef_X360 Crystal Structure Of Y323f Inactive Mutant Of P38al 5e-05
3ody_X360 Crystal Structure Of P38alpha Y323q Active Mutant L 5e-05
1di9_A360 The Structure Of P38 Mitogen-Activated Protein Kina 5e-05
3od6_X360 Crystal Structure Of P38alpha Y323t Active Mutant L 5e-05
3e92_A371 Crystal Structure Of P38 Kinase In Complex With A B 5e-05
3hvc_A362 Crystal Structure Of Human P38alpha Map Kinase Leng 5e-05
2fso_X367 Mitogen Activated Protein Kinase P38alpha (D176a) A 5e-05
2fst_X367 Mitogen Activated Protein Kinase P38alpha (d176a+f3 5e-05
3s3i_A349 P38 Kinase Crystal Structure In Complex With Small 5e-05
3py3_A380 Crystal Structure Of Phosphorylated P38alpha Map Ki 5e-05
3gcu_A360 Human P38 Map Kinase In Complex With Rl48 Length = 5e-05
4fux_A360 Crystal Structure Of The Erk2 Complexed With E75 Le 5e-05
2oza_B366 Structure Of P38alpha Complex Length = 366 6e-05
4fv6_A360 Crystal Structure Of The Erk2 Complexed With E57 Le 6e-05
3rp9_A458 Crystal Structure Of The Apo Mapk From Toxoplasma G 6e-05
2fsl_X367 Mitogen Activated Protein Kinase P38alpha (D176a+f3 6e-05
4gsb_A364 Monoclinic Crystal Form Of The Apo-Erk2 Length = 36 6e-05
3hec_A348 P38 In Complex With Imatinib Length = 348 6e-05
4fv7_A360 Crystal Structure Of The Erk2 Complexed With E94 Le 6e-05
1zzl_A351 Crystal Structure Of P38 With Triazolopyridine Leng 6e-05
3dls_A335 Crystal Structure Of Human Pas Kinase Bound To Adp 6e-05
3k3j_A362 P38alpha Bound To Novel Dfg-Out Compound Pf-0041612 6e-05
3nnx_A354 Crystal Structure Of Phosphorylated P38 Alpha In Co 6e-05
3qc9_A543 Crystal Structure Of Cross-Linked Bovine Grk1 T8cN4 6e-05
3qc9_A543 Crystal Structure Of Cross-Linked Bovine Grk1 T8cN4 6e-05
4e5a_X360 The W197a Mutant Of P38a Map Kinase Length = 360 6e-05
4id7_A273 Ack1 Kinase In Complex With The Inhibitor Cis-3-[8- 6e-05
3zsg_A362 X-Ray Structure Of P38alpha Bound To Tak-715 Length 6e-05
3nnu_A354 Crystal Structure Of P38 Alpha In Complex With Dp13 6e-05
4ewq_A383 Human P38 Alpha Mapk In Complex With A Pyridazine B 6e-05
3k3i_A350 P38alpha Bound To Novel Dgf-Out Compound Pf-0021595 6e-05
1oz1_A372 P38 Mitogen-Activated Kinase In Complex With 4-Azai 6e-05
2gfs_A372 P38 Kinase Crystal Structure In Complex With Ro3201 6e-05
1m7q_A366 Crystal Structure Of P38 Map Kinase In Complex With 6e-05
3oht_A389 Crystal Structure Of Salmo Salar P38alpha Length = 7e-05
3mpt_A371 Crystal Structure Of P38 Kinase In Complex With A P 7e-05
1bl6_A379 The Complex Structure Of The Map Kinase P38SB216995 7e-05
4hzr_A277 Crystal Structure Of Ack1 Kinase Domain Length = 27 7e-05
3og7_A289 B-Raf Kinase V600e Oncogenic Mutant In Complex With 7e-05
3kq7_A380 Structure Of Human P38alpha With N-[4-Methyl-3-(6-{ 7e-05
2lgc_A359 Joint Nmr And X-Ray Refinement Reveals The Structur 7e-05
2y9q_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 7e-05
3dt1_A383 P38 Complexed With A Quinazoline Inhibitor Length = 7e-05
1bi8_A326 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 7e-05
1bi8_A326 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 2e-04
4dn5_A356 Crystal Structure Of Nf-kb-inducing Kinase (nik) Le 7e-05
4dn5_A356 Crystal Structure Of Nf-kb-inducing Kinase (nik) Le 1e-04
3sa0_A360 Complex Of Erk2 With Norathyriol Length = 360 7e-05
1ian_A366 Human P38 Map Kinase Inhibitor Complex Length = 366 8e-05
3eb0_A383 Crystal Structure Of Cgd4_240 From Cryptosporidium 8e-05
1wzy_A368 Crystal Structure Of Human Erk2 Complexed With A Py 8e-05
1tvo_A368 The Structure Of Erk2 In Complex With A Small Molec 8e-05
3qyw_A364 Crystal Structure Of Erk2 In Complex With An Inhibi 8e-05
3qa8_A 676 Crystal Structure Of Inhibitor Of Kappa B Kinase Be 9e-05
3r63_A358 Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 9e-05
3rzf_A 677 Crystal Structure Of Inhibitor Of Kappab Kinase Bet 9e-05
3zu7_A365 Crystal Structure Of A Designed Selected Ankyrin Re 9e-05
2z7l_A366 Unphosphorylated Mitogen Activated Protein Kinase E 9e-05
3c9w_A357 Crystal Structure Of Erk-2 With Hypothemycin Covale 9e-05
2ojg_A380 Crystal Structure Of Erk2 In Complex With N,n-dimet 9e-05
2fys_B364 Crystal Structure Of Erk2 Complex With Kim Peptide 9e-05
3zuv_A364 Crystal Structure Of A Designed Selected Ankyrin Re 9e-05
2erk_A365 Phosphorylated Map Kinase Erk2 Length = 365 9e-05
4g3d_A371 Crystal Structure Of Human Nf-kappab Inducing Kinas 1e-04
3o71_A358 Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length 1e-04
4h3q_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 1e-04
1jow_B308 Crystal Structure Of A Complex Of Human Cdk6 And A 1e-04
1jow_B308 Crystal Structure Of A Complex Of Human Cdk6 And A 2e-04
3tei_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 1e-04
2gph_A364 Docking Motif Interactions In The Map Kinase Erk2 L 1e-04
3nup_A307 Cdk6 (Monomeric) In Complex With Inhibitor Length = 1e-04
3nup_A307 Cdk6 (Monomeric) In Complex With Inhibitor Length = 2e-04
2jav_A279 Human Kinase With Pyrrole-Indolinone Ligand Length 1e-04
2w5a_A279 Human Nek2 Kinase Adp-Bound Length = 279 1e-04
1uwh_A276 The Complex Of Wild Type B-Raf And Bay439006 Length 2e-04
3p1a_A311 Structure Of Human Membrane-Associated Tyrosine- An 2e-04
2ivv_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 2e-04
4apc_A350 Crystal Structure Of Human Nima-Related Kinase 1 (N 2e-04
3mh2_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 2e-04
2w96_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 2e-04
3n9x_A432 Crystal Structure Of Map Kinase From Plasmodium Ber 2e-04
3p86_A309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 2e-04
2i6l_A320 Crystal Structure Of Human Mitogen Activated Protei 2e-04
3gp0_A348 Crystal Structure Of Human Mitogen Activated Protei 2e-04
4eut_A396 Structure Of Bx-795 Complexed With Unphosphorylated 2e-04
1gol_A364 Coordinates Of Rat Map Kinase Erk2 With An Arginine 2e-04
4euu_A319 Structure Of Bx-795 Complexed With Human Tbk1 Kinas 2e-04
2zoq_A382 Structural Dissection Of Human Mitogen-Activated Ki 2e-04
2i1m_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An 2e-04
3bea_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A P 2e-04
4anm_A335 Complex Of Ck2 With A Cdc7 Inhibitor Length = 335 3e-04
4anm_A335 Complex Of Ck2 With A Cdc7 Inhibitor Length = 335 6e-04
3gc9_A370 The Structure Of P38beta C119s, C162s In Complex Wi 3e-04
1mqb_A333 Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro 3e-04
1ds5_A332 Dimeric Crystal Structure Of The Alpha Subunit In C 3e-04
1ds5_A332 Dimeric Crystal Structure Of The Alpha Subunit In C 6e-04
2qc6_A332 Protein Kinase Ck2 In Complex With Dbc Length = 332 3e-04
2qc6_A332 Protein Kinase Ck2 In Complex With Dbc Length = 332 6e-04
1daw_A327 Crystal Structure Of A Binary Complex Of Protein Ki 3e-04
1daw_A327 Crystal Structure Of A Binary Complex Of Protein Ki 7e-04
3pvg_A331 Crystal Structure Of Z. Mays Ck2 Alpha Subunit In C 3e-04
3pvg_A331 Crystal Structure Of Z. Mays Ck2 Alpha Subunit In C 7e-04
1m2p_A325 Crystal Structure Of 1,8-Di-Hydroxy-4-Nitro- Anthra 3e-04
1m2p_A325 Crystal Structure Of 1,8-Di-Hydroxy-4-Nitro- Anthra 7e-04
4dgn_A326 Crystal Structure Of Maize Ck2 In Complex With The 3e-04
4dgn_A326 Crystal Structure Of Maize Ck2 In Complex With The 7e-04
3gc8_A370 The Structure Of P38beta C162s In Complex With A Di 3e-04
2w9f_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 3e-04
3kxg_A327 Crystal Structure Of Z. Mays Ck2 Kinase Alpha Subun 3e-04
3kxg_A327 Crystal Structure Of Z. Mays Ck2 Kinase Alpha Subun 7e-04
2w99_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 3e-04
4dgm_A326 Crystal Structure Of Maize Ck2 In Complex With The 3e-04
4dgm_A326 Crystal Structure Of Maize Ck2 In Complex With The 7e-04
3ppz_A309 Crystal Structure Of Ctr1 Kinase Domain In Complex 3e-04
2pvh_A352 Structure-Based Design Of Pyrazolo[1,5-A][1,3,5]tri 3e-04
2pvh_A352 Structure-Based Design Of Pyrazolo[1,5-A][1,3,5]tri 9e-04
2vwu_A302 Ephb4 Kinase Domain Inhibitor Complex Length = 302 4e-04
3o8p_A360 Conformational Plasticity Of P38 Map Kinase Dfg Mot 4e-04
4aw5_A291 Complex Of The Ephb4 Kinase Domain With An Oxindole 4e-04
1rjb_A344 Crystal Structure Of Flt3 Length = 344 4e-04
3gi3_A360 Crystal Structure Of A N-Phenyl-N'-Naphthylurea Ana 5e-04
2ivt_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 5e-04
3ofm_A350 Structure Of A Human Ck2alpha Prime, The Paralog Is 5e-04
2ivs_A314 Crystal Structure Of Non-Phosphorylated Ret Tyrosin 5e-04
3e3b_X339 Crystal Structure Of Catalytic Subunit Of Human Pro 5e-04
2p2h_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 5e-04
2p2i_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 6e-04
3mh0_A360 Mutagenesis Of P38 Map Kinase Eshtablishes Key Role 6e-04
3vid_A356 Crystal Structure Of Human Vegfr2 Kinase Domain Wit 6e-04
3juh_A335 Crystal Structure Of A Mutant Of Human Protein Kina 6e-04
3vhk_A368 Crystal Structure Of The Vegfr2 Kinase Domain In Co 6e-04
3p23_A432 Crystal Structure Of The Human Kinase And Rnase Dom 6e-04
3p23_A432 Crystal Structure Of The Human Kinase And Rnase Dom 8e-04
4a4x_A279 Nek2-Ede Bound To Cct248662 Length = 279 7e-04
1y6a_A366 Crystal Structure Of Vegfr2 In Complex With A 2-Ani 7e-04
3vhe_A359 Crystal Structure Of Human Vegfr2 Kinase Domain Wit 7e-04
3c7q_A316 Structure Of Vegfr2 Kinase Domain In Complex With B 7e-04
2oh4_A316 Crystal Structure Of Vegfr2 With A Benzimidazole-Ur 7e-04
1ywn_A316 Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]p 7e-04
3mh3_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 8e-04
2r7i_A335 Crystal Structure Of Catalytic Subunit Of Protein K 8e-04
3ewh_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 8e-04
3q9w_A336 Crystal Structure Of Human Ck2 Alpha In Complex Wit 8e-04
3mh1_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 8e-04
3nga_A333 Human Ck2 Catalytic Domain In Complex With Cx-4945 8e-04
3llt_A360 Crystal Structure Of Pf14_0431, Kinase Domain Lengt 8e-04
3h30_A334 Crystal Structure Of The Catalytic Subunit Of Human 8e-04
3nsz_A330 Human Ck2 Catalytic Domain In Complex With Amppn Le 8e-04
3bqc_A335 High Ph-Value Crystal Structure Of Emodin In Comple 8e-04
1pjk_A334 Crystal Structure Of A C-terminal Deletion Mutant O 9e-04
3q04_A328 Crystal Structure Of The Apo-Form Of Human Ck2 Alph 9e-04
1jwh_A337 Crystal Structure Of Human Protein Kinase Ck2 Holoe 9e-04
4dgl_C335 Crystal Structure Of The Ck2 Tetrameric Holoenzyme 9e-04
3u6j_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 9e-04
>pdb|1KOB|A Chain A, Twitchin Kinase Fragment (Aplysia), Autoregulated Protein Kinase Domain Length = 387 Back     alignment and structure

Iteration: 1

Score = 113 bits (283), Expect = 6e-25, Method: Compositional matrix adjust. Identities = 61/170 (35%), Positives = 92/170 (54%), Gaps = 7/170 (4%) Query: 174 VKTRTKPITDAYDFGDELGRGVTGIVYHAVERSSGRNYAAKVMTGKGNQYKSLFKNELDI 233 V+ + + D YD +ELG G G+V+ VE+++GR + AK + K KNE+ I Sbjct: 42 VEVKQGSVYDYYDILEELGSGAFGVVHRCVEKATGRVFVAKFINTPYPLDKYTVKNEISI 101 Query: 234 MNQLCHRNLVRLHDSYETKDSFTIISELAGGGELLHSLTRQSY-YTEYDIAHYIRQLLSG 292 MNQL H L+ LHD++E K +I E GGEL + + Y +E ++ +Y+RQ G Sbjct: 102 MNQLHHPKLINLHDAFEDKYEMVLILEFLSGGELFDRIAAEDYKMSEAEVINYMRQACEG 161 Query: 293 LDYMHRLSIAHLGLTPGDLLVAHPGGRHLLLTDFGLSRRITSFGKLNPLE 342 L +MH SI HL + P +++ + + DFGL+ KLNP E Sbjct: 162 LKHMHEHSIVHLDIKPENIMCETKKASSVKIIDFGLAT------KLNPDE 205
>pdb|1KOB|A Chain A, Twitchin Kinase Fragment (Aplysia), Autoregulated Protein Kinase Domain Length = 387 Back     alignment and structure
>pdb|1KOB|A Chain A, Twitchin Kinase Fragment (Aplysia), Autoregulated Protein Kinase Domain Length = 387 Back     alignment and structure
>pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 Back     alignment and structure
>pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 Back     alignment and structure
>pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 Back     alignment and structure
>pdb|2YA9|A Chain A, Crystal Structure Of The Autoinhibited Form Of Mouse Dapk2 Length = 361 Back     alignment and structure
>pdb|2YA9|A Chain A, Crystal Structure Of The Autoinhibited Form Of Mouse Dapk2 Length = 361 Back     alignment and structure
>pdb|2YA9|A Chain A, Crystal Structure Of The Autoinhibited Form Of Mouse Dapk2 Length = 361 Back     alignment and structure
>pdb|1WMK|A Chain A, Human Death-Associated Kinase Drp-1, Mutant S308d D40 Length = 321 Back     alignment and structure
>pdb|1WMK|A Chain A, Human Death-Associated Kinase Drp-1, Mutant S308d D40 Length = 321 Back     alignment and structure
>pdb|1WMK|A Chain A, Human Death-Associated Kinase Drp-1, Mutant S308d D40 Length = 321 Back     alignment and structure
>pdb|2A27|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 8 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|2A27|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 8 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|2A27|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 8 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|2A2A|A Chain A, High-resolution Crystallographic Analysis Of The Autoinhibited Conformation Of A Human Death-associated Protein Kinase Length = 321 Back     alignment and structure
>pdb|2A2A|A Chain A, High-resolution Crystallographic Analysis Of The Autoinhibited Conformation Of A Human Death-associated Protein Kinase Length = 321 Back     alignment and structure
>pdb|2A2A|A Chain A, High-resolution Crystallographic Analysis Of The Autoinhibited Conformation Of A Human Death-associated Protein Kinase Length = 321 Back     alignment and structure
>pdb|1Z9X|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 3 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|1Z9X|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 3 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|1Z9X|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 3 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 Back     alignment and structure
>pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 Back     alignment and structure
>pdb|1ZWS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Drp-1 Kinase Length = 288 Back     alignment and structure
>pdb|1ZWS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Drp-1 Kinase Length = 288 Back     alignment and structure
>pdb|1ZWS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Drp-1 Kinase Length = 288 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|2W4O|A Chain A, Crystal Structure Of Human Camk4 In Complex With 4-Amino( Sulfamoyl-Phenylamino)-Triazole-Carbothioic Acid (2,6- Difluoro-Phenyl)-Amide) Length = 349 Back     alignment and structure
>pdb|2W4O|A Chain A, Crystal Structure Of Human Camk4 In Complex With 4-Amino( Sulfamoyl-Phenylamino)-Triazole-Carbothioic Acid (2,6- Difluoro-Phenyl)-Amide) Length = 349 Back     alignment and structure
>pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 Back     alignment and structure
>pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 Back     alignment and structure
>pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 Back     alignment and structure
>pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 Back     alignment and structure
>pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 Back     alignment and structure
>pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 Back     alignment and structure
>pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 Back     alignment and structure
>pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 Back     alignment and structure
>pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 Back     alignment and structure
>pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 Back     alignment and structure
>pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 Back     alignment and structure
>pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 Back     alignment and structure
>pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|3KK9|A Chain A, Camkii Substrate Complex B Length = 282 Back     alignment and structure
>pdb|3KK9|A Chain A, Camkii Substrate Complex B Length = 282 Back     alignment and structure
>pdb|3KK9|A Chain A, Camkii Substrate Complex B Length = 282 Back     alignment and structure
>pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 Back     alignment and structure
>pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 Back     alignment and structure
>pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 Back     alignment and structure
>pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 Back     alignment and structure
>pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 Back     alignment and structure
>pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 Back     alignment and structure
>pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 Back     alignment and structure
>pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 Back     alignment and structure
>pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 Back     alignment and structure
>pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 Back     alignment and structure
>pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 Back     alignment and structure
>pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 Back     alignment and structure
>pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 Back     alignment and structure
>pdb|3LM0|A Chain A, Crystal Structure Of Human SerineTHREONINE KINASE 17B (STK17B) Length = 327 Back     alignment and structure
>pdb|3LM0|A Chain A, Crystal Structure Of Human SerineTHREONINE KINASE 17B (STK17B) Length = 327 Back     alignment and structure
>pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 Back     alignment and structure
>pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 Back     alignment and structure
>pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 Back     alignment and structure
>pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 Back     alignment and structure
>pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 Back     alignment and structure
>pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 Back     alignment and structure
>pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 Back     alignment and structure
>pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 Back     alignment and structure
>pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 Back     alignment and structure
>pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 Back     alignment and structure
>pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 Back     alignment and structure
>pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 Back     alignment and structure
>pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 Back     alignment and structure
>pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 Back     alignment and structure
>pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 Back     alignment and structure
>pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 Back     alignment and structure
>pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 Back     alignment and structure
>pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 Back     alignment and structure
>pdb|1TKI|A Chain A, Autoinhibited Serine Kinase Domain Of The Giant Muscle Protein Titin Length = 321 Back     alignment and structure
>pdb|1TKI|A Chain A, Autoinhibited Serine Kinase Domain Of The Giant Muscle Protein Titin Length = 321 Back     alignment and structure
>pdb|1TKI|A Chain A, Autoinhibited Serine Kinase Domain Of The Giant Muscle Protein Titin Length = 321 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|3F3Z|A Chain A, Crystal Structure Of Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 In Presence Of Indirubin E804 Length = 277 Back     alignment and structure
>pdb|3F3Z|A Chain A, Crystal Structure Of Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 In Presence Of Indirubin E804 Length = 277 Back     alignment and structure
>pdb|3F3Z|A Chain A, Crystal Structure Of Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 In Presence Of Indirubin E804 Length = 277 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|2QG5|A Chain A, Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 Length = 294 Back     alignment and structure
>pdb|2QG5|A Chain A, Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 Length = 294 Back     alignment and structure
>pdb|2QG5|A Chain A, Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 Length = 294 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|3HKO|A Chain A, Crystal Structure Of A Cdpk Kinase Domain From Cryptosporidium Parvum, Cgd7_40 Length = 345 Back     alignment and structure
>pdb|3HKO|A Chain A, Crystal Structure Of A Cdpk Kinase Domain From Cryptosporidium Parvum, Cgd7_40 Length = 345 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 Back     alignment and structure
>pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 Back     alignment and structure
>pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 Back     alignment and structure
>pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 Back     alignment and structure
>pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 Back     alignment and structure
>pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 Back     alignment and structure
>pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 Back     alignment and structure
>pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 Back     alignment and structure
>pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 Back     alignment and structure
>pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 Back     alignment and structure
>pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 Back     alignment and structure
>pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 Back     alignment and structure
>pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 Back     alignment and structure
>pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 Back     alignment and structure
>pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 Back     alignment and structure
>pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 Back     alignment and structure
>pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 Back     alignment and structure
>pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 Back     alignment and structure
>pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 Back     alignment and structure
>pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 Back     alignment and structure
>pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 Back     alignment and structure
>pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 Back     alignment and structure
>pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 Back     alignment and structure
>pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 Back     alignment and structure
>pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 Back     alignment and structure
>pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 Back     alignment and structure
>pdb|3KA0|A Chain A, Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4-Ylamino)-2- Hydroxyphenyl)-N-Methylbenzo[b]thiophene-2-Carboxamide Length = 320 Back     alignment and structure
>pdb|3KA0|A Chain A, Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4-Ylamino)-2- Hydroxyphenyl)-N-Methylbenzo[b]thiophene-2-Carboxamide Length = 320 Back     alignment and structure
>pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 Back     alignment and structure
>pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|2OZA|A Chain A, Structure Of P38alpha Complex Length = 356 Back     alignment and structure
>pdb|2OZA|A Chain A, Structure Of P38alpha Complex Length = 356 Back     alignment and structure
>pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 Back     alignment and structure
>pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 Back     alignment and structure
>pdb|1KWP|A Chain A, Crystal Structure Of Mapkap2 Length = 400 Back     alignment and structure
>pdb|1KWP|A Chain A, Crystal Structure Of Mapkap2 Length = 400 Back     alignment and structure
>pdb|4FR4|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase 32a (Yank1) Length = 384 Back     alignment and structure
>pdb|2ONL|C Chain C, Crystal Structure Of The P38a-Mapkap Kinase 2 Heterodimer Length = 406 Back     alignment and structure
>pdb|2ONL|C Chain C, Crystal Structure Of The P38a-Mapkap Kinase 2 Heterodimer Length = 406 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|2P3G|X Chain X, Crystal Structure Of A Pyrrolopyridine Inhibitor Bound To Mapkap Kinase-2 Length = 327 Back     alignment and structure
>pdb|2P3G|X Chain X, Crystal Structure Of A Pyrrolopyridine Inhibitor Bound To Mapkap Kinase-2 Length = 327 Back     alignment and structure
>pdb|2JBO|A Chain A, Protein Kinase Mk2 In Complex With An Inhibitor (Crystal Form-1, Soaking) Length = 326 Back     alignment and structure
>pdb|2JBO|A Chain A, Protein Kinase Mk2 In Complex With An Inhibitor (Crystal Form-1, Soaking) Length = 326 Back     alignment and structure
>pdb|3R2Y|A Chain A, Mk2 Kinase Bound To Compound 1 Length = 319 Back     alignment and structure
>pdb|3R2Y|A Chain A, Mk2 Kinase Bound To Compound 1 Length = 319 Back     alignment and structure
>pdb|3R2B|A Chain A, Mk2 Kinase Bound To Compound 5b Length = 318 Back     alignment and structure
>pdb|3R2B|A Chain A, Mk2 Kinase Bound To Compound 5b Length = 318 Back     alignment and structure
>pdb|3FPM|A Chain A, Crystal Structure Of A Squarate Inhibitor Bound To Mapkap Kinase-2 Length = 325 Back     alignment and structure
>pdb|3FPM|A Chain A, Crystal Structure Of A Squarate Inhibitor Bound To Mapkap Kinase-2 Length = 325 Back     alignment and structure
>pdb|2PZY|A Chain A, Structure Of Mk2 Complexed With Compound 76 Length = 324 Back     alignment and structure
>pdb|2PZY|A Chain A, Structure Of Mk2 Complexed With Compound 76 Length = 324 Back     alignment and structure
>pdb|3GOK|A Chain A, Binding Site Mapping Of Protein Ligands Length = 334 Back     alignment and structure
>pdb|3GOK|A Chain A, Binding Site Mapping Of Protein Ligands Length = 334 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|2QR7|A Chain A, 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2: Se-Met Derivative Length = 342 Back     alignment and structure
>pdb|2QR7|A Chain A, 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2: Se-Met Derivative Length = 342 Back     alignment and structure
>pdb|2AC5|A Chain A, Structure Of Human Mnk2 Kinase Domain Mutant D228g Length = 316 Back     alignment and structure
>pdb|2AC5|A Chain A, Structure Of Human Mnk2 Kinase Domain Mutant D228g Length = 316 Back     alignment and structure
>pdb|1NXK|A Chain A, Crystal Structure Of Staurosporine Bound To Map Kap Kinase 2 Length = 400 Back     alignment and structure
>pdb|1NXK|A Chain A, Crystal Structure Of Staurosporine Bound To Map Kap Kinase 2 Length = 400 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 Back     alignment and structure
>pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 Back     alignment and structure
>pdb|3KN5|A Chain A, Crystal Structure Of The C-Terminal Kinase Domain Of Msk1 In With Amp-Pnp Length = 325 Back     alignment and structure
>pdb|3KN5|A Chain A, Crystal Structure Of The C-Terminal Kinase Domain Of Msk1 In With Amp-Pnp Length = 325 Back     alignment and structure
>pdb|3KN5|A Chain A, Crystal Structure Of The C-Terminal Kinase Domain Of Msk1 In With Amp-Pnp Length = 325 Back     alignment and structure
>pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 Back     alignment and structure
>pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 Back     alignment and structure
>pdb|3C0G|A Chain A, Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Length = 351 Back     alignment and structure
>pdb|3C0G|A Chain A, Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Length = 351 Back     alignment and structure
>pdb|3TAC|A Chain A, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 361 Back     alignment and structure
>pdb|3TAC|A Chain A, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 361 Back     alignment and structure
>pdb|2QR8|A Chain A, 2.0a X-ray Structure Of C-terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 (rsk2) Length = 342 Back     alignment and structure
>pdb|2QR8|A Chain A, 2.0a X-ray Structure Of C-terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 (rsk2) Length = 342 Back     alignment and structure
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 Back     alignment and structure
>pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 Back     alignment and structure
>pdb|2HW6|A Chain A, Crystal Structure Of Mnk1 Catalytic Domain Length = 307 Back     alignment and structure
>pdb|2HW6|A Chain A, Crystal Structure Of Mnk1 Catalytic Domain Length = 307 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|2CN5|A Chain A, Crystal Structure Of Human Chk2 In Complex With Adp Length = 329 Back     alignment and structure
>pdb|2CN5|A Chain A, Crystal Structure Of Human Chk2 In Complex With Adp Length = 329 Back     alignment and structure
>pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 Back     alignment and structure
>pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 Back     alignment and structure
>pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|2YCR|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv976 Length = 323 Back     alignment and structure
>pdb|2YCR|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv976 Length = 323 Back     alignment and structure
>pdb|3R1N|A Chain A, Mk3 Kinase Bound To Compound 5b Length = 317 Back     alignment and structure
>pdb|3R1N|A Chain A, Mk3 Kinase Bound To Compound 5b Length = 317 Back     alignment and structure
>pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 Back     alignment and structure
>pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 Back     alignment and structure
>pdb|2YCF|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv1531 Length = 322 Back     alignment and structure
>pdb|2YCF|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv1531 Length = 322 Back     alignment and structure
>pdb|3FHR|A Chain A, High Resolution Crystal Structure Of Mitogen-Activated Protein Kinase-Activated Protein Kinase 3 (Mk3)-Inhibitor Complex Length = 336 Back     alignment and structure
>pdb|3FHR|A Chain A, High Resolution Crystal Structure Of Mitogen-Activated Protein Kinase-Activated Protein Kinase 3 (Mk3)-Inhibitor Complex Length = 336 Back     alignment and structure
>pdb|2XK9|A Chain A, Structural Analysis Of Checkpoint Kinase 2 (Chk2) In Complex With Inhibitor Pv1533 Length = 322 Back     alignment and structure
>pdb|2XK9|A Chain A, Structural Analysis Of Checkpoint Kinase 2 (Chk2) In Complex With Inhibitor Pv1533 Length = 322 Back     alignment and structure
>pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 Back     alignment and structure
>pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 Back     alignment and structure
>pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 Back     alignment and structure
>pdb|2W0J|A Chain A, Crystal Structure Of Chk2 In Complex With Nsc 109555, A Specific Inhibitor Length = 323 Back     alignment and structure
>pdb|2W0J|A Chain A, Crystal Structure Of Chk2 In Complex With Nsc 109555, A Specific Inhibitor Length = 323 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|2QUR|A Chain A, Crystal Structure Of F327aK285P MUTANT OF CAMP-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|2QUR|A Chain A, Crystal Structure Of F327aK285P MUTANT OF CAMP-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme Camp-Dependent Protein Kinase Catalytic Subunit Length = 350 Back     alignment and structure
>pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme Camp-Dependent Protein Kinase Catalytic Subunit Length = 350 Back     alignment and structure
>pdb|3FHI|A Chain A, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 350 Back     alignment and structure
>pdb|3FHI|A Chain A, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 350 Back     alignment and structure
>pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|2ERZ|E Chain E, Crystal Structure Of C-amp Dependent Kinase (pka) Bound To Hydroxyfasudil Length = 351 Back     alignment and structure
>pdb|2ERZ|E Chain E, Crystal Structure Of C-amp Dependent Kinase (pka) Bound To Hydroxyfasudil Length = 351 Back     alignment and structure
>pdb|1JBP|E Chain E, Crystal Structure Of The Catalytic Subunit Of Camp- Dependent Protein Kinase Complexed With A Substrate Peptide, Adp And Detergent Length = 350 Back     alignment and structure
>pdb|1JBP|E Chain E, Crystal Structure Of The Catalytic Subunit Of Camp- Dependent Protein Kinase Complexed With A Substrate Peptide, Adp And Detergent Length = 350 Back     alignment and structure
>pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistidine-Tagged Recombinant Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With The Peptide Inhibitor Pki(5-24) And Adenosine Length = 350 Back     alignment and structure
>pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistidine-Tagged Recombinant Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With The Peptide Inhibitor Pki(5-24) And Adenosine Length = 350 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|1SYK|A Chain A, Crystal Structure Of E230q Mutant Of Camp-Dependent Protein Kinase Reveals Unexpected Apoenzyme Conformation Length = 350 Back     alignment and structure
>pdb|1SYK|A Chain A, Crystal Structure Of E230q Mutant Of Camp-Dependent Protein Kinase Reveals Unexpected Apoenzyme Conformation Length = 350 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|3QAM|E Chain E, Crystal Structure Of Glu208ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3QAM|E Chain E, Crystal Structure Of Glu208ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3QAL|E Chain E, Crystal Structure Of Arg280ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3QAL|E Chain E, Crystal Structure Of Arg280ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic Subunit Of Camp-Dependent Protein Kinase And Adenosine Further Defines Conformational Flexibility Length = 350 Back     alignment and structure
>pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic Subunit Of Camp-Dependent Protein Kinase And Adenosine Further Defines Conformational Flexibility Length = 350 Back     alignment and structure
>pdb|2GU8|A Chain A, Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel And Potent Inhibitors For Akt: Synthesis And Sar Studies Length = 337 Back     alignment and structure
>pdb|2GU8|A Chain A, Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel And Potent Inhibitors For Akt: Synthesis And Sar Studies Length = 337 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2AC3|A Chain A, Structure Of Human Mnk2 Kinase Domain Length = 316 Back     alignment and structure
>pdb|2AC3|A Chain A, Structure Of Human Mnk2 Kinase Domain Length = 316 Back     alignment and structure
>pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 Back     alignment and structure
>pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 Back     alignment and structure
>pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 Back     alignment and structure
>pdb|1APM|E Chain E, 2.0 Angstrom Refined Crystal Structure Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With A Peptide Inhibitor And Detergent Length = 350 Back     alignment and structure
>pdb|1APM|E Chain E, 2.0 Angstrom Refined Crystal Structure Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With A Peptide Inhibitor And Detergent Length = 350 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|3I6U|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 419 Back     alignment and structure
>pdb|3I6U|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 419 Back     alignment and structure
>pdb|4DFY|A Chain A, Crystal Structure Of R194a Mutant Of Camp-Dependent Protein Kinase With Unphosphorylated Activation Loop Length = 371 Back     alignment and structure
>pdb|4DFY|A Chain A, Crystal Structure Of R194a Mutant Of Camp-Dependent Protein Kinase With Unphosphorylated Activation Loop Length = 371 Back     alignment and structure
>pdb|3PVB|A Chain A, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 345 Back     alignment and structure
>pdb|3PVB|A Chain A, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 345 Back     alignment and structure
>pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 Back     alignment and structure
>pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|1OMW|A Chain A, Crystal Structure Of The Complex Between G Protein-Coupled Receptor Kinase 2 And Heterotrimeric G Protein Beta 1 And Gamma 2 Subunits Length = 689 Back     alignment and structure
>pdb|3PSC|A Chain A, Bovine Grk2 In Complex With Gbetagamma Subunits Length = 695 Back     alignment and structure
>pdb|1L3R|E Chain E, Crystal Structure Of A Transition State Mimic Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1L3R|E Chain E, Crystal Structure Of A Transition State Mimic Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3KRW|A Chain A, Human Grk2 In Complex With Gbetgamma Subunits And Balanol (Soak) Length = 688 Back     alignment and structure
>pdb|3KRW|A Chain A, Human Grk2 In Complex With Gbetgamma Subunits And Balanol (Soak) Length = 688 Back     alignment and structure
>pdb|3CIK|A Chain A, Human Grk2 In Complex With Gbetagamma Subunits Length = 689 Back     alignment and structure
>pdb|3CIK|A Chain A, Human Grk2 In Complex With Gbetagamma Subunits Length = 689 Back     alignment and structure
>pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 Back     alignment and structure
>pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 Back     alignment and structure
>pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 Back     alignment and structure
>pdb|3O7L|B Chain B, Crystal Structure Of Phospholamban (1-19):pka C-Subunit:amp-Pnp:mg2+ Complex Length = 350 Back     alignment and structure
>pdb|3O7L|B Chain B, Crystal Structure Of Phospholamban (1-19):pka C-Subunit:amp-Pnp:mg2+ Complex Length = 350 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|2QCS|A Chain A, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 350 Back     alignment and structure
>pdb|2QCS|A Chain A, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 350 Back     alignment and structure
>pdb|3I6W|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 443 Back     alignment and structure
>pdb|3I6W|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 443 Back     alignment and structure
>pdb|4DFX|E Chain E, Crystal Structure Of Myristoylated K7c Catalytic Subunit Of Camp- Dependent Protein Kinase In Complex With Sp20 And Amp-Pnp Length = 350 Back     alignment and structure
>pdb|4DFX|E Chain E, Crystal Structure Of Myristoylated K7c Catalytic Subunit Of Camp- Dependent Protein Kinase In Complex With Sp20 And Amp-Pnp Length = 350 Back     alignment and structure
>pdb|3UDB|A Chain A, Crystal Structure Of Snrk2.6 Length = 317 Back     alignment and structure
>pdb|3UDB|A Chain A, Crystal Structure Of Snrk2.6 Length = 317 Back     alignment and structure
>pdb|3UDB|A Chain A, Crystal Structure Of Snrk2.6 Length = 317 Back     alignment and structure
>pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 Back     alignment and structure
>pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|4DG3|E Chain E, Crystal Structure Of R336a Mutant Of Camp-dependent Protein Kinase With Unphosphorylated Turn Motif Length = 371 Back     alignment and structure
>pdb|4DG3|E Chain E, Crystal Structure Of R336a Mutant Of Camp-dependent Protein Kinase With Unphosphorylated Turn Motif Length = 371 Back     alignment and structure
>pdb|4FSU|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSU|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 Back     alignment and structure
>pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 Back     alignment and structure
>pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 Back     alignment and structure
>pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 Back     alignment and structure
>pdb|4FSZ|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSZ|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|4FSY|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSY|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 Back     alignment and structure
>pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 Back     alignment and structure
>pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|2YDJ|A Chain A, Discovery Of Checkpoint Kinase Inhibitor Azd7762 By Structure Based Design And Optimization Of Thiophene Carboxamide Ureas Length = 276 Back     alignment and structure
>pdb|2YDJ|A Chain A, Discovery Of Checkpoint Kinase Inhibitor Azd7762 By Structure Based Design And Optimization Of Thiophene Carboxamide Ureas Length = 276 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|4FT3|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FT3|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSW|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSW|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 Back     alignment and structure
>pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 Back     alignment and structure
>pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 Back     alignment and structure
>pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 Back     alignment and structure
>pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 Back     alignment and structure
>pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 Back     alignment and structure
>pdb|4FSM|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSM|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSN|A Chain A, Crystal Structure Of The Chk1 Length = 278 Back     alignment and structure
>pdb|4FSN|A Chain A, Crystal Structure Of The Chk1 Length = 278 Back     alignment and structure
>pdb|2X8E|A Chain A, Discovery Of A Novel Class Of Triazolones As Checkpoint Kinase Inhibitors - Hit To Lead Exploration Length = 276 Back     alignment and structure
>pdb|2X8E|A Chain A, Discovery Of A Novel Class Of Triazolones As Checkpoint Kinase Inhibitors - Hit To Lead Exploration Length = 276 Back     alignment and structure
>pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 Back     alignment and structure
>pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 Back     alignment and structure
>pdb|4FST|A Chain A, Crystal Structure Of The Chk1 Length = 269 Back     alignment and structure
>pdb|4FST|A Chain A, Crystal Structure Of The Chk1 Length = 269 Back     alignment and structure
>pdb|2GHG|A Chain A, H-Chk1 Complexed With A431994 Length = 269 Back     alignment and structure
>pdb|2GHG|A Chain A, H-Chk1 Complexed With A431994 Length = 269 Back     alignment and structure
>pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|2E9V|A Chain A, Structure Of H-Chk1 Complexed With A859017 Length = 268 Back     alignment and structure
>pdb|2E9V|A Chain A, Structure Of H-Chk1 Complexed With A859017 Length = 268 Back     alignment and structure
>pdb|2BR1|A Chain A, Structure-Based Design Of Novel Chk1 Inhibitors: Insights Into Hydrogen Bonding And Protein-Ligand Affinity Length = 297 Back     alignment and structure
>pdb|2BR1|A Chain A, Structure-Based Design Of Novel Chk1 Inhibitors: Insights Into Hydrogen Bonding And Protein-Ligand Affinity Length = 297 Back     alignment and structure
>pdb|1IA8|A Chain A, The 1.7 A Crystal Structure Of Human Cell Cycle Checkpoint Kinase Chk1 Length = 289 Back     alignment and structure
>pdb|1IA8|A Chain A, The 1.7 A Crystal Structure Of Human Cell Cycle Checkpoint Kinase Chk1 Length = 289 Back     alignment and structure
>pdb|1ZLT|A Chain A, Crystal Structure Of Chk1 Complexed With A Hymenaldisine Analog Length = 295 Back     alignment and structure
>pdb|1ZLT|A Chain A, Crystal Structure Of Chk1 Complexed With A Hymenaldisine Analog Length = 295 Back     alignment and structure
>pdb|2HOG|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 20 Length = 322 Back     alignment and structure
>pdb|2HOG|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 20 Length = 322 Back     alignment and structure
>pdb|2R0U|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 54 Length = 323 Back     alignment and structure
>pdb|2R0U|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 54 Length = 323 Back     alignment and structure
>pdb|3OT3|A Chain A, X-Ray Crystal Structure Of Compound 22k Bound To Human Chk1 Kinase Domain Length = 273 Back     alignment and structure
>pdb|3OT3|A Chain A, X-Ray Crystal Structure Of Compound 22k Bound To Human Chk1 Kinase Domain Length = 273 Back     alignment and structure
>pdb|3JVR|A Chain A, Characterization Of The Chk1 Allosteric Inhibitor Binding Site Length = 271 Back     alignment and structure
>pdb|3JVR|A Chain A, Characterization Of The Chk1 Allosteric Inhibitor Binding Site Length = 271 Back     alignment and structure
>pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 Back     alignment and structure
>pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 Back     alignment and structure
>pdb|2AYP|A Chain A, Crystal Structure Of Chk1 With An Indol Inhibitor Length = 269 Back     alignment and structure
>pdb|2AYP|A Chain A, Crystal Structure Of Chk1 With An Indol Inhibitor Length = 269 Back     alignment and structure
>pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 Back     alignment and structure
>pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 Back     alignment and structure
>pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 Back     alignment and structure
>pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 Back     alignment and structure
>pdb|3L9M|A Chain A, Crystal Structure Of Pkab3 (Pka Triple Mutant V123a, L173m, Q181k) With Compound 18 Length = 351 Back     alignment and structure
>pdb|3L9M|A Chain A, Crystal Structure Of Pkab3 (Pka Triple Mutant V123a, L173m, Q181k) With Compound 18 Length = 351 Back     alignment and structure
>pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 Back     alignment and structure
>pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 Back     alignment and structure
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure
>pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 Back     alignment and structure
>pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 Back     alignment and structure
>pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 Back     alignment and structure
>pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 Back     alignment and structure
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 Back     alignment and structure
>pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 Back     alignment and structure
>pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 Back     alignment and structure
>pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 Back     alignment and structure
>pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 Back     alignment and structure
>pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 Back     alignment and structure
>pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 Back     alignment and structure
>pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 Back     alignment and structure
>pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 Back     alignment and structure
>pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 Back     alignment and structure
>pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|1ZYS|A Chain A, Co-Crystal Structure Of Checkpoint Kinase Chk1 With A Pyrrolo-Pyridine Inhibitor Length = 273 Back     alignment and structure
>pdb|1ZYS|A Chain A, Co-Crystal Structure Of Checkpoint Kinase Chk1 With A Pyrrolo-Pyridine Inhibitor Length = 273 Back     alignment and structure
>pdb|1SMH|A Chain A, Protein Kinase A Variant Complex With Completely Ordered N- Terminal Helix Length = 350 Back     alignment and structure
>pdb|1SMH|A Chain A, Protein Kinase A Variant Complex With Completely Ordered N- Terminal Helix Length = 350 Back     alignment and structure
>pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 Back     alignment and structure
>pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 Back     alignment and structure
>pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 Back     alignment and structure
>pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 Back     alignment and structure
>pdb|1XH9|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|1XH9|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 Back     alignment and structure
>pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 Back     alignment and structure
>pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 Back     alignment and structure
>pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 Back     alignment and structure
>pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 Back     alignment and structure
>pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 Back     alignment and structure
>pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 Back     alignment and structure
>pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 Back     alignment and structure
>pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|4AE6|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit Calpha 2 Length = 343 Back     alignment and structure
>pdb|4AE6|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit Calpha 2 Length = 343 Back     alignment and structure
>pdb|3AGL|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-1039 Length = 351 Back     alignment and structure
>pdb|3AGL|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-1039 Length = 351 Back     alignment and structure
>pdb|3AGM|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-670 Length = 351 Back     alignment and structure
>pdb|3AGM|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-670 Length = 351 Back     alignment and structure
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|3NX8|A Chain A, Human Camp Dependent Protein Kinase In Complex With Phenol Length = 351 Back     alignment and structure
>pdb|3NX8|A Chain A, Human Camp Dependent Protein Kinase In Complex With Phenol Length = 351 Back     alignment and structure
>pdb|1YDT|E Chain E, Structure Of Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With H89 Protein Kinase Inhibitor N-[2- (4-Bromocinnamylamino)ethyl]-5-Isoquinoline Length = 350 Back     alignment and structure
>pdb|1YDT|E Chain E, Structure Of Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With H89 Protein Kinase Inhibitor N-[2- (4-Bromocinnamylamino)ethyl]-5-Isoquinoline Length = 350 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb In Complex With Mgatp Length = 350 Back     alignment and structure
>pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb In Complex With Mgatp Length = 350 Back     alignment and structure
>pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 Back     alignment and structure
>pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 Back     alignment and structure
>pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 Back     alignment and structure
>pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 Back     alignment and structure
>pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 Back     alignment and structure
>pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 Back     alignment and structure
>pdb|3MVJ|A Chain A, Human Cyclic Amp-Dependent Protein Kinase Pka Inhibitor Complex Length = 371 Back     alignment and structure
>pdb|3MVJ|A Chain A, Human Cyclic Amp-Dependent Protein Kinase Pka Inhibitor Complex Length = 371 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb Length = 350 Back     alignment and structure
>pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb Length = 350 Back     alignment and structure
>pdb|4AE9|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit C Alpha 2 Length = 343 Back     alignment and structure
>pdb|4AE9|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit C Alpha 2 Length = 343 Back     alignment and structure
>pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 Back     alignment and structure
>pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 Back     alignment and structure
>pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 Back     alignment and structure
>pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 Back     alignment and structure
>pdb|1CTP|E Chain E, Structure Of The Mammalian Catalytic Subunit Of Camp-Dependent Protein Kinase And An Inhibitor Peptide Displays An Open Conformation Length = 350 Back     alignment and structure
>pdb|1CTP|E Chain E, Structure Of The Mammalian Catalytic Subunit Of Camp-Dependent Protein Kinase And An Inhibitor Peptide Displays An Open Conformation Length = 350 Back     alignment and structure
>pdb|2UZT|A Chain A, Pka Structures Of Akt, Indazole-Pyridine Inhibitors Length = 336 Back     alignment and structure
>pdb|2UZT|A Chain A, Pka Structures Of Akt, Indazole-Pyridine Inhibitors Length = 336 Back     alignment and structure
>pdb|1CDK|A Chain A, Camp-Dependent Protein Kinase Catalytic Subunit (E.C.2.7.1.37) (Protein Kinase A) Complexed With Protein Kinase Inhibitor Peptide Fragment 5-24 (Pki(5-24) Isoelectric Variant Ca) And Mn2+ Adenylyl Imidodiphosphate (Mnamp-Pnp) At Ph 5.6 And 7c And 4c Length = 350 Back     alignment and structure
>pdb|1CDK|A Chain A, Camp-Dependent Protein Kinase Catalytic Subunit (E.C.2.7.1.37) (Protein Kinase A) Complexed With Protein Kinase Inhibitor Peptide Fragment 5-24 (Pki(5-24) Isoelectric Variant Ca) And Mn2+ Adenylyl Imidodiphosphate (Mnamp-Pnp) At Ph 5.6 And 7c And 4c Length = 350 Back     alignment and structure
>pdb|3NYN|A Chain A, Crystal Structure Of G Protein-Coupled Receptor Kinase 6 In Complex With Sangivamycin Length = 576 Back     alignment and structure
>pdb|3NYN|A Chain A, Crystal Structure Of G Protein-Coupled Receptor Kinase 6 In Complex With Sangivamycin Length = 576 Back     alignment and structure
>pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylmaleimide 2 To Protein Kinase A (Pka) Length = 350 Back     alignment and structure
>pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylmaleimide 2 To Protein Kinase A (Pka) Length = 350 Back     alignment and structure
>pdb|2C1A|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With Isoquinoline-5-Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl)amide Length = 351 Back     alignment and structure
>pdb|2C1A|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With Isoquinoline-5-Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl)amide Length = 351 Back     alignment and structure
>pdb|1SVH|A Chain A, Crystal Structure Of Protein Kinase A In Complex With Azepane Derivative 8 Length = 350 Back     alignment and structure
>pdb|1SVH|A Chain A, Crystal Structure Of Protein Kinase A In Complex With Azepane Derivative 8 Length = 350 Back     alignment and structure
>pdb|2F7E|E Chain E, Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoquinolin-6- Yl-Pyridin-3-Yloxymethyl-Etylamine Length = 351 Back     alignment and structure
>pdb|2F7E|E Chain E, Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoquinolin-6- Yl-Pyridin-3-Yloxymethyl-Etylamine Length = 351 Back     alignment and structure
>pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With Staurosporine Length = 350 Back     alignment and structure
>pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With Staurosporine Length = 350 Back     alignment and structure
>pdb|3DND|A Chain A, Camp-Dependent Protein Kinase Pka Catalytic Subunit With Pki-5-24 Length = 350 Back     alignment and structure
>pdb|3DND|A Chain A, Camp-Dependent Protein Kinase Pka Catalytic Subunit With Pki-5-24 Length = 350 Back     alignment and structure
>pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 Back     alignment and structure
>pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 Back     alignment and structure
>pdb|1CMK|E Chain E, Crystal Structures Of The Myristylated Catalytic Subunit Of Camp- Dependent Protein Kinase Reveal Open And Closed Conformations Length = 350 Back     alignment and structure
>pdb|1CMK|E Chain E, Crystal Structures Of The Myristylated Catalytic Subunit Of Camp- Dependent Protein Kinase Reveal Open And Closed Conformations Length = 350 Back     alignment and structure
>pdb|4AW2|A Chain A, Crystal Structure Of Cdc42 Binding Protein Kinase Alpha (Mrck Alpha) Length = 437 Back     alignment and structure
>pdb|3AMA|A Chain A, Protein Kinase A Sixfold Mutant Model Of Aurora B With Inhibitor Jnj- 7706621 Length = 351 Back     alignment and structure
>pdb|3AMA|A Chain A, Protein Kinase A Sixfold Mutant Model Of Aurora B With Inhibitor Jnj- 7706621 Length = 351 Back     alignment and structure
>pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|1XH7|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|1XH7|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-Dependent Protein Kinase In Complex With Rho-Kinase Inhibitor Fasudil (Ha-1077) Length = 350 Back     alignment and structure
>pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-Dependent Protein Kinase In Complex With Rho-Kinase Inhibitor Fasudil (Ha-1077) Length = 350 Back     alignment and structure
>pdb|2JDS|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With A- 443654 Length = 351 Back     alignment and structure
>pdb|2JDS|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With A- 443654 Length = 351 Back     alignment and structure
>pdb|3PWY|A Chain A, Crystal Structure Of An Extender (Spd28345)-Modified Human Pdk1 Complex 2 Length = 311 Back     alignment and structure
>pdb|3PWY|A Chain A, Crystal Structure Of An Extender (Spd28345)-Modified Human Pdk1 Complex 2 Length = 311 Back     alignment and structure
>pdb|2JDT|A Chain A, Structure Of Pka-Pkb Chimera Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 351 Back     alignment and structure
>pdb|2JDT|A Chain A, Structure Of Pka-Pkb Chimera Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 351 Back     alignment and structure
>pdb|2VO0|A Chain A, Structure Of Pka-Pkb Chimera Complexed With C-(4-(4- Chlorophenyl)-1-(7h-Pyrrolo(2, 3-D)pyrimidin-4-Yl)piperidin- 4-Yl)methylamine Length = 351 Back     alignment and structure
>pdb|2VO0|A Chain A, Structure Of Pka-Pkb Chimera Complexed With C-(4-(4- Chlorophenyl)-1-(7h-Pyrrolo(2, 3-D)pyrimidin-4-Yl)piperidin- 4-Yl)methylamine Length = 351 Back     alignment and structure
>pdb|2VD5|A Chain A, Structure Of Human Myotonic Dystrophy Protein Kinase In Complex With The Bisindoylmaleide Inhibitor Bim Viii Length = 412 Back     alignment and structure
>pdb|2VD5|A Chain A, Structure Of Human Myotonic Dystrophy Protein Kinase In Complex With The Bisindoylmaleide Inhibitor Bim Viii Length = 412 Back     alignment and structure
>pdb|3GGF|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase Mst4 In Complex With An Quinazolin Length = 301 Back     alignment and structure
>pdb|3GGF|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase Mst4 In Complex With An Quinazolin Length = 301 Back     alignment and structure
>pdb|2UVY|A Chain A, Structure Of Pka-pkb Chimera Complexed With Methyl-(4-(9h- Purin-6-yl)-benzyl)-amine Length = 351 Back     alignment and structure
>pdb|2UVY|A Chain A, Structure Of Pka-pkb Chimera Complexed With Methyl-(4-(9h- Purin-6-yl)-benzyl)-amine Length = 351 Back     alignment and structure
>pdb|1UV5|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With 6-Bromoindirubin-3'-Oxime Length = 350 Back     alignment and structure
>pdb|1UV5|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With 6-Bromoindirubin-3'-Oxime Length = 350 Back     alignment and structure
>pdb|1H8F|A Chain A, Glycogen Synthase Kinase 3 Beta. Length = 352 Back     alignment and structure
>pdb|1H8F|A Chain A, Glycogen Synthase Kinase 3 Beta. Length = 352 Back     alignment and structure
>pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 Back     alignment and structure
>pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 Back     alignment and structure
>pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 Back     alignment and structure
>pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 Back     alignment and structure
>pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 Back     alignment and structure
>pdb|3V8S|A Chain A, Human Rho-Associated Protein Kinase 1 (Rock 1) In Complex With Indazole Derivative (Compound 18) Length = 410 Back     alignment and structure
>pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 Back     alignment and structure
>pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 Back     alignment and structure
>pdb|2ESM|A Chain A, Crystal Structure Of Rock 1 Bound To Fasudil Length = 415 Back     alignment and structure
>pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 Back     alignment and structure
>pdb|2V55|A Chain A, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 406 Back     alignment and structure
>pdb|1H4L|A Chain A, Structure And Regulation Of The Cdk5-P25(Nck5a) Complex Length = 292 Back     alignment and structure
>pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 Back     alignment and structure
>pdb|4EC8|A Chain A, Structure Of Full Length Cdk9 In Complex With Cyclint And Drb Length = 373 Back     alignment and structure
>pdb|2ZV2|A Chain A, Crystal Structure Of Human CalciumCALMODULIN-Dependent Protein Kinase Kinase 2, Beta, Camkk2 Kinase Domain In Complex With Sto-609 Length = 298 Back     alignment and structure
>pdb|2ZV2|A Chain A, Crystal Structure Of Human CalciumCALMODULIN-Dependent Protein Kinase Kinase 2, Beta, Camkk2 Kinase Domain In Complex With Sto-609 Length = 298 Back     alignment and structure
>pdb|4IC7|A Chain A, Crystal Structure Of The Erk5 Kinase Domain In Complex With An Mkk5 Binding Fragment Length = 442 Back     alignment and structure
>pdb|1ZRZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Atypical Protein Kinase C-Iota Length = 364 Back     alignment and structure
>pdb|3MI9|A Chain A, Crystal Structure Of Hiv-1 Tat Complexed With Human P-Tefb Length = 351 Back     alignment and structure
>pdb|3A8W|A Chain A, Crystal Structure Of Pkciota Kinase Domain Length = 345 Back     alignment and structure
>pdb|2WTK|C Chain C, Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo25alpha Complex Length = 305 Back     alignment and structure
>pdb|3ZH8|A Chain A, A Novel Small Molecule Apkc Inhibitor Length = 349 Back     alignment and structure
>pdb|4BCF|A Chain A, Structure Of Cdk9 In Complex With Cyclin T And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 331 Back     alignment and structure
>pdb|4B99|A Chain A, Crystal Structure Of Mapk7 (Erk5) With Inhibitor Length = 398 Back     alignment and structure
>pdb|1O9U|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide Length = 350 Back     alignment and structure
>pdb|1O9U|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide Length = 350 Back     alignment and structure
>pdb|3BLH|A Chain A, Crystal Structure Of Human Cdk9CYCLINT1 Length = 331 Back     alignment and structure
>pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 Back     alignment and structure
>pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 Back     alignment and structure
>pdb|4DC2|A Chain A, Structure Of Pkc In Complex With A Substrate Peptide From Par-3 Length = 396 Back     alignment and structure
>pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 Back     alignment and structure
>pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 Back     alignment and structure
>pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 Back     alignment and structure
>pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 Back     alignment and structure
>pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 Back     alignment and structure
>pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 Back     alignment and structure
>pdb|1UNG|A Chain A, Structural Mechanism For The Inhibition Of Cdk5-P25 By Roscovitine, Aloisine And Indirubin. Length = 292 Back     alignment and structure
>pdb|3FPQ|A Chain A, Crystal Structure Of The Kinase Domain Of Wnk1 Length = 290 Back     alignment and structure
>pdb|3SAY|A Chain A, Crystal Structure Of Human Glycogen Synthase Kinase 3 Beta (Gsk3b) In Complex With Inhibitor 142 Length = 430 Back     alignment and structure
>pdb|3SAY|A Chain A, Crystal Structure Of Human Glycogen Synthase Kinase 3 Beta (Gsk3b) In Complex With Inhibitor 142 Length = 430 Back     alignment and structure
>pdb|4AFJ|A Chain A, 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selective Gsk-3 Inhibitors Length = 367 Back     alignment and structure
>pdb|4AFJ|A Chain A, 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selective Gsk-3 Inhibitors Length = 367 Back     alignment and structure
>pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 Back     alignment and structure
>pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 Back     alignment and structure
>pdb|1GNG|A Chain A, Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With Frattide Peptide Length = 378 Back     alignment and structure
>pdb|1GNG|A Chain A, Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With Frattide Peptide Length = 378 Back     alignment and structure
>pdb|4DIT|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Imidazopyridine Inhibitor Length = 382 Back     alignment and structure
>pdb|4DIT|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Imidazopyridine Inhibitor Length = 382 Back     alignment and structure
>pdb|1Q5K|A Chain A, Crystal Structure Of Glycogen Synthase Kinase 3 In Complexed With Inhibitor Length = 414 Back     alignment and structure
>pdb|1Q5K|A Chain A, Crystal Structure Of Glycogen Synthase Kinase 3 In Complexed With Inhibitor Length = 414 Back     alignment and structure
>pdb|1I09|A Chain A, Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Length = 420 Back     alignment and structure
>pdb|1I09|A Chain A, Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Length = 420 Back     alignment and structure
>pdb|2OW3|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With Bis- (Indole)maleimide Pyridinophane Inhibitor Length = 352 Back     alignment and structure
>pdb|2OW3|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With Bis- (Indole)maleimide Pyridinophane Inhibitor Length = 352 Back     alignment and structure
>pdb|2O5K|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Benzoimidazol Inhibitor Length = 372 Back     alignment and structure
>pdb|2O5K|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Benzoimidazol Inhibitor Length = 372 Back     alignment and structure
>pdb|3ZDI|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide And Inhibitor 7d Length = 350 Back     alignment and structure
>pdb|3ZDI|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide And Inhibitor 7d Length = 350 Back     alignment and structure
>pdb|3SD0|A Chain A, Identification Of A Glycogen Synthase Kinase-3b Inhibitor That Attenuates Hyperactivity In Clock Mutant Mice Length = 350 Back     alignment and structure
>pdb|3SD0|A Chain A, Identification Of A Glycogen Synthase Kinase-3b Inhibitor That Attenuates Hyperactivity In Clock Mutant Mice Length = 350 Back     alignment and structure
>pdb|3F7Z|A Chain A, X-ray Co-crystal Structure Of Glycogen Synthase Kinase 3beta In Complex With An Inhibitor Length = 350 Back     alignment and structure
>pdb|3F7Z|A Chain A, X-ray Co-crystal Structure Of Glycogen Synthase Kinase 3beta In Complex With An Inhibitor Length = 350 Back     alignment and structure
>pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 Back     alignment and structure
>pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 Back     alignment and structure
>pdb|1PYX|A Chain A, Gsk-3 Beta Complexed With Amp-Pnp Length = 422 Back     alignment and structure
>pdb|1PYX|A Chain A, Gsk-3 Beta Complexed With Amp-Pnp Length = 422 Back     alignment and structure
>pdb|3ZRK|A Chain A, Identification Of 2-(4-Pyridyl)thienopyridinones As Gsk-3beta Inhibitors Length = 371 Back     alignment and structure
>pdb|3ZRK|A Chain A, Identification Of 2-(4-Pyridyl)thienopyridinones As Gsk-3beta Inhibitors Length = 371 Back     alignment and structure
>pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|1UA2|A Chain A, Crystal Structure Of Human Cdk7 Length = 346 Back     alignment and structure
>pdb|3THB|A Chain A, Structure Of Plk1 Kinase Domain In Complex With A Benzolactam-Derived Inhibitor Length = 333 Back     alignment and structure
>pdb|3THB|A Chain A, Structure Of Plk1 Kinase Domain In Complex With A Benzolactam-Derived Inhibitor Length = 333 Back     alignment and structure
>pdb|3MTL|A Chain A, Crystal Structure Of The Pctaire1 Kinase In Complex With Ind E804 Length = 324 Back     alignment and structure
>pdb|2V5Q|A Chain A, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 315 Back     alignment and structure
>pdb|2V5Q|A Chain A, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 315 Back     alignment and structure
>pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|1Q3D|A Chain A, Gsk-3 Beta Complexed With Staurosporine Length = 424 Back     alignment and structure
>pdb|1Q3D|A Chain A, Gsk-3 Beta Complexed With Staurosporine Length = 424 Back     alignment and structure
>pdb|2OU7|A Chain A, Structure Of The Catalytic Domain Of Human Polo-Like Kinase 1 Length = 335 Back     alignment and structure
>pdb|2OU7|A Chain A, Structure Of The Catalytic Domain Of Human Polo-Like Kinase 1 Length = 335 Back     alignment and structure
>pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 Back     alignment and structure
>pdb|3F88|A Chain A, Glycogen Synthase Kinase 3beta Inhibitor Complex Length = 349 Back     alignment and structure
>pdb|3F88|A Chain A, Glycogen Synthase Kinase 3beta Inhibitor Complex Length = 349 Back     alignment and structure
>pdb|1R0E|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With 3-Indolyl-4- Arylmaleimide Inhibitor Length = 391 Back     alignment and structure
>pdb|1R0E|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With 3-Indolyl-4- Arylmaleimide Inhibitor Length = 391 Back     alignment and structure
>pdb|3GB2|A Chain A, Gsk3beta Inhibitor Complex Length = 353 Back     alignment and structure
>pdb|3GB2|A Chain A, Gsk3beta Inhibitor Complex Length = 353 Back     alignment and structure
>pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 Back     alignment and structure
>pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 Back     alignment and structure
>pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 Back     alignment and structure
>pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 Back     alignment and structure
>pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 Back     alignment and structure
>pdb|2YAC|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With Nms-P937 Length = 311 Back     alignment and structure
>pdb|2YAC|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With Nms-P937 Length = 311 Back     alignment and structure
>pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 Back     alignment and structure
>pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 Back     alignment and structure
>pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 Back     alignment and structure
>pdb|3KB7|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 311 Back     alignment and structure
>pdb|3KB7|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 311 Back     alignment and structure
>pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 Back     alignment and structure
>pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 Back     alignment and structure
>pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 Back     alignment and structure
>pdb|4ACC|A Chain A, Gsk3b In Complex With Inhibitor Length = 465 Back     alignment and structure
>pdb|4ACC|A Chain A, Gsk3b In Complex With Inhibitor Length = 465 Back     alignment and structure
>pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 Back     alignment and structure
>pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 Back     alignment and structure
>pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 Back     alignment and structure
>pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 Back     alignment and structure
>pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|1CM8|A Chain A, Phosphorylated Map Kinase P38-Gamma Length = 367 Back     alignment and structure
>pdb|1CM8|A Chain A, Phosphorylated Map Kinase P38-Gamma Length = 367 Back     alignment and structure
>pdb|2RKU|A Chain A, Structure Of Plk1 In Complex With Bi2536 Length = 294 Back     alignment and structure
>pdb|2RKU|A Chain A, Structure Of Plk1 In Complex With Bi2536 Length = 294 Back     alignment and structure
>pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 Back     alignment and structure
>pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 Back     alignment and structure
>pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 Back     alignment and structure
>pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 Back     alignment and structure
>pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 Back     alignment and structure
>pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 Back     alignment and structure
>pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 Back     alignment and structure
>pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 Back     alignment and structure
>pdb|3E7O|A Chain A, Crystal Structure Of Jnk2 Length = 360 Back     alignment and structure
>pdb|3E7O|A Chain A, Crystal Structure Of Jnk2 Length = 360 Back     alignment and structure
>pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 Back     alignment and structure
>pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 Back     alignment and structure
>pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 Back     alignment and structure
>pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 Back     alignment and structure
>pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 Back     alignment and structure
>pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 Back     alignment and structure
>pdb|2B9H|A Chain A, Crystal Structure Of Fus3 With A Docking Motif From Ste7 Length = 353 Back     alignment and structure
>pdb|2F9G|A Chain A, Crystal Structure Of Fus3 Phosphorylated On Tyr182 Length = 353 Back     alignment and structure
>pdb|2B9F|A Chain A, Crystal Structure Of Non-Phosphorylated Fus3 Length = 353 Back     alignment and structure
>pdb|3KGA|A Chain A, Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexed With A Potent 3-Aminopyrazole Atp Site Inhibitor Length = 299 Back     alignment and structure
>pdb|2F2U|A Chain A, Crystal Structure Of The Rho-Kinase Kinase Domain Length = 402 Back     alignment and structure
>pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 Back     alignment and structure
>pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 Back     alignment and structure
>pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 Back     alignment and structure
>pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 Back     alignment and structure
>pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 Back     alignment and structure
>pdb|3NPC|A Chain A, Crystal Structure Of Jnk2 Complexed With Birb796 Length = 364 Back     alignment and structure
>pdb|3NPC|A Chain A, Crystal Structure Of Jnk2 Complexed With Birb796 Length = 364 Back     alignment and structure
>pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 Back     alignment and structure
>pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|3NIE|A Chain A, Crystal Structure Of Pf11_0147 Length = 429 Back     alignment and structure
>pdb|3S95|A Chain A, Crystal Structure Of The Human Limk1 Kinase Domain In Complex With Staurosporine Length = 310 Back     alignment and structure
>pdb|3V3V|A Chain A, Structural And Functional Analysis Of Quercetagetin, A Natural Jnk1 Inhibitor Length = 379 Back     alignment and structure
>pdb|3V3V|A Chain A, Structural And Functional Analysis Of Quercetagetin, A Natural Jnk1 Inhibitor Length = 379 Back     alignment and structure
>pdb|2G01|A Chain A, Pyrazoloquinolones As Novel, Selective Jnk1 Inhibitors Length = 370 Back     alignment and structure
>pdb|1Q8Y|A Chain A, The Structure Of The Yeast Sr Protein Kinase, Sky1p, With Bound Adp Length = 373 Back     alignment and structure
>pdb|1HOW|A Chain A, The X-Ray Crystal Structure Of Sky1p, An Sr Protein Kinase In Yeast Length = 373 Back     alignment and structure
>pdb|3FI3|A Chain A, Crystal Structure Of Jnk3 With Indazole Inhibitor, Sr-3737 Length = 364 Back     alignment and structure
>pdb|3O17|A Chain A, Crystal Structure Of Jnk1-Alpha1 Isoform Length = 370 Back     alignment and structure
>pdb|2X7F|A Chain A, Crystal Structure Of The Kinase Domain Of Human Traf2- And Nck-Interacting Kinase With Wee1chk1 Inhibitor Length = 326 Back     alignment and structure
>pdb|2X7F|A Chain A, Crystal Structure Of The Kinase Domain Of Human Traf2- And Nck-Interacting Kinase With Wee1chk1 Inhibitor Length = 326 Back     alignment and structure
>pdb|4G3G|A Chain A, Crystal Structure Of Murine Nf-kappab Inducing Kinase (nik) V408l Bound To A 2-(aminothiazolyl)phenol (cmp3) Length = 350 Back     alignment and structure
>pdb|4G3F|A Chain A, Crystal Structure Of Murine Nf-kappab Inducing Kinase (nik) Bound To A 2-(aminothiazoly)phenol (cmp2) Length = 336 Back     alignment and structure
>pdb|4G3C|A Chain A, Crystal Structure Of Apo Murine Nf-kappab Inducing Kinase (nik) Length = 352 Back     alignment and structure
>pdb|3VUH|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M3 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUH|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M3 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|2PZI|A Chain A, Crystal Structure Of Protein Kinase Pkng From Mycobacterium Tuberculosis In Complex With Tetrahydrobenzothiophene Ax20017 Length = 681 Back     alignment and structure
>pdb|3FV8|A Chain A, Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Length = 355 Back     alignment and structure
>pdb|3VUI|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUI|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3KVX|A Chain A, Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Length = 364 Back     alignment and structure
>pdb|3VUM|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M7 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUM|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M7 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 Back     alignment and structure
>pdb|2R9S|A Chain A, C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Quinoline Inhibitor Length = 356 Back     alignment and structure
>pdb|3OXI|A Chain A, Design And Synthesis Of Disubstituted Thiophene And Thiazole Based Inhibitors Of Jnk For The Treatment Of Neurodegenerative Diseases Length = 362 Back     alignment and structure
>pdb|2O0U|A Chain A, Crystal Structure Of Human Jnk3 Complexed With N-{3-Cyano-6-[3-(1- Piperidinyl)propanoyl]-4,5,6,7-Tetrahydrothieno[2, 3-C]pyridin-2-Yl}- 1-Naphthalenecarboxamide Length = 364 Back     alignment and structure
>pdb|1PMN|A Chain A, Crystal Structure Of Jnk3 In Complex With An Imidazole- Pyrimidine Inhibitor Length = 364 Back     alignment and structure
>pdb|3PTG|A Chain A, Design And Synthesis Of A Novel, Orally Efficacious Tri-Substituted Thiophene Based Jnk Inhibitor Length = 363 Back     alignment and structure
>pdb|2OK1|A Chain A, Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3- Chlorophenyl)-1h-Pyrazol-3-Yl)-1h-Pyrrole-2-Carboxamide Length = 365 Back     alignment and structure
>pdb|4H36|A Chain A, Crystal Structure Of Jnk3 In Complex With Atf2 Peptide Length = 356 Back     alignment and structure
>pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 Back     alignment and structure
>pdb|2EXC|X Chain X, Inhibitor Complex Of Jnk3 Length = 356 Back     alignment and structure
>pdb|2B1P|A Chain A, Inhibitor Complex Of Jnk3 Length = 355 Back     alignment and structure
>pdb|3VUG|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUG|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUL|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUL|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUK|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M5 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUK|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M5 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3FI2|A Chain A, Crystal Structure Of Jnk3 With Amino-Pyrazole Inhibitor, Sr- 3451 Length = 353 Back     alignment and structure
>pdb|1JNK|A Chain A, The C-Jun N-Terminal Kinase (Jnk3s) Complexed With Mgamp-Pnp Length = 423 Back     alignment and structure
>pdb|3COI|A Chain A, Crystal Structure Of P38delta Kinase Length = 353 Back     alignment and structure
>pdb|3COI|A Chain A, Crystal Structure Of P38delta Kinase Length = 353 Back     alignment and structure
>pdb|3TTJ|A Chain A, Crystal Structure Of Jnk3 Complexed With Cc-359, A Jnk Inhibitor For The Prevention Of Ischemia-Reperfusion Injury Length = 464 Back     alignment and structure
>pdb|3PZE|A Chain A, Jnk1 In Complex With Inhibitor Length = 358 Back     alignment and structure
>pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 Back     alignment and structure
>pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 Back     alignment and structure
>pdb|1UKH|A Chain A, Structural Basis For The Selective Inhibition Of Jnk1 By The Scaffolding Protein Jip1 And Sp600125 Length = 369 Back     alignment and structure
>pdb|1UKH|A Chain A, Structural Basis For The Selective Inhibition Of Jnk1 By The Scaffolding Protein Jip1 And Sp600125 Length = 369 Back     alignment and structure
>pdb|4EXU|A Chain A, Mapk13, Inactive Form Length = 371 Back     alignment and structure
>pdb|4EXU|A Chain A, Mapk13, Inactive Form Length = 371 Back     alignment and structure
>pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 Back     alignment and structure
>pdb|3VUD|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUD|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|2XS0|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 386 Back     alignment and structure
>pdb|2XS0|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 386 Back     alignment and structure
>pdb|3ELJ|A Chain A, Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine Inhibitor Length = 369 Back     alignment and structure
>pdb|2PML|X Chain X, Crystal Structure Of Pfpk7 In Complex With An Atp Analogue Length = 348 Back     alignment and structure
>pdb|2XRW|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 371 Back     alignment and structure
>pdb|2XRW|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 371 Back     alignment and structure
>pdb|2IN6|A Chain A, Wee1 Kinase Complex With Inhibitor Pd311839 Length = 287 Back     alignment and structure
>pdb|2Z2W|A Chain A, Humand Wee1 Kinase Complexed With Inhibitor Pf0335770 Length = 285 Back     alignment and structure
>pdb|3F69|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Pknb Mutant Kinase Domain In Complex With Kt5720 Length = 311 Back     alignment and structure
>pdb|3BI6|A Chain A, Wee1 Kinase Complex With Inhibitor Pd352396 Length = 287 Back     alignment and structure
>pdb|1X8B|A Chain A, Structure Of Human Wee1a Kinase: Kinase Domain Complexed With Inhibitor Pd0407824 Length = 289 Back     alignment and structure
>pdb|1PME|A Chain A, Structure Of Penta Mutant Human Erk2 Map Kinase Complexed With A Specific Inhibitor Of Human P38 Map Kinase Length = 380 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|4E7W|A Chain A, Structure Of Gsk3 From Ustilago Maydis Length = 394 Back     alignment and structure
>pdb|4AGU|A Chain A, Crystal Structure Of The Human Cdkl1 Kinase Domain Length = 311 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|3F61|A Chain A, Crystal Structure Of M. Tuberculosis Pknb Leu33aspVAL222ASP DOUBLE MUTANT IN COMPLEX WITH ADP Length = 311 Back     alignment and structure
>pdb|3OZ6|A Chain A, Crystal Structure Of Mapk From Cryptosporidium Parvum, Cgd2_1960 Length = 388 Back     alignment and structure
>pdb|1NA7|A Chain A, Crystal Structure Of The Catalytic Subunit Of Human Protein Kinase Ck2 Length = 329 Back     alignment and structure
>pdb|1NA7|A Chain A, Crystal Structure Of The Catalytic Subunit Of Human Protein Kinase Ck2 Length = 329 Back     alignment and structure
>pdb|3ORI|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain L33d Mutant (Crystal Form 1) Length = 311 Back     alignment and structure
>pdb|1O6Y|A Chain A, Catalytic Domain Of Pknb Kinase From Mycobacterium Tuberculosis Length = 299 Back     alignment and structure
>pdb|1MRU|A Chain A, Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycobacterium Tuberculosis Pknb. Length = 311 Back     alignment and structure
>pdb|3ORM|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain D76a Mutant Length = 311 Back     alignment and structure
>pdb|3D83|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|2BAQ|A Chain A, P38alpha Bound To Ro3201195 Length = 365 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|2PUU|A Chain A, Crystal Structure Of P38 Complex With 1-(5-Tert-Butyl-2-P- Tolyl-2h-Pyrazol-3-Yl)-3-[4-(6-Morpholin-4-Ylmethyl- Pyridin-3-Yl)naphthalen-1-Yl]urea Length = 348 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|1YWR|A Chain A, Crystal Structure Analysis Of Inactive P38 Kinase Domain In Complex With A Monocyclic Pyrazolone Inhibitor Length = 360 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|3D7Z|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|3GCP|A Chain A, Human P38 Map Kinase In Complex With Sb203580 Length = 360 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|1YW2|A Chain A, Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 Back     alignment and structure
>pdb|1LEW|A Chain A, Crystal Structure Of Map Kinase P38 Complexed To The Docking Site On Its Nuclear Substrate Mef2a Length = 360 Back     alignment and structure
>pdb|3P4K|A Chain A, The Third Conformation Of P38a Map Kinase Observed In Phosphorylated P38a And In Solution Length = 370 Back     alignment and structure
>pdb|4HZS|A Chain A, Crystal Structure Of Ack1 Kinase Domain With C-terminal Sh3 Domain Length = 341 Back     alignment and structure
>pdb|1U5Q|A Chain A, Crystal Structure Of The Tao2 Kinase Domain: Activation And Specifity Of A Ste20p Map3k Length = 348 Back     alignment and structure
>pdb|2GCD|A Chain A, Tao2 Kinase Domain-Staurosporine Structure Length = 309 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|2BAL|A Chain A, P38alpha Map Kinase Bound To Pyrazoloamine Length = 365 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|2Y8O|A Chain A, Crystal Structure Of Human P38alpha Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|3EQP|B Chain B, Crystal Structure Of Ack1 With Compound T95 Length = 276 Back     alignment and structure
>pdb|1U54|A Chain A, Crystal Structures Of The Phosphorylated And Unphosphorylated Kinase Domains Of The Cdc42-Associated Tyrosine Kinase Ack1 Bound To Amp-Pcp Length = 291 Back     alignment and structure
>pdb|3T8O|A Chain A, Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolution Length = 543 Back     alignment and structure
>pdb|2GHL|A Chain A, Mutant Mus Musculus P38 Kinase Domain In Complex With Inhibitor Pg-874743 Length = 348 Back     alignment and structure
>pdb|3ODZ|X Chain X, Crystal Structure Of P38alpha Y323r Active Mutant Length = 360 Back     alignment and structure
>pdb|3C4X|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.9a Length = 543 Back     alignment and structure
>pdb|2GTM|A Chain A, Mutated Mouse P38 Map Kinase Domain In Complex With Inhibitor Pg-892579 Length = 348 Back     alignment and structure
>pdb|2BAJ|A Chain A, P38alpha Bound To Pyrazolourea Length = 365 Back     alignment and structure
>pdb|3FI4|A Chain A, P38 Kinase Crystal Structure In Complex With Ro4499 Length = 372 Back     alignment and structure
>pdb|3HRB|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 359 Back     alignment and structure
>pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 Back     alignment and structure
>pdb|3C4W|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.7a Length = 543 Back     alignment and structure
>pdb|1BMK|A Chain A, The Complex Structure Of The Map Kinase P38SB218655 Length = 379 Back     alignment and structure
>pdb|1U46|A Chain A, Crystal Structure Of The Unphosphorylated Kinase Domain Of The Tyrosine Kinase Ack1 Length = 291 Back     alignment and structure
>pdb|1OVE|A Chain A, The Structure Of P38 Alpha In Complex With A Dihydroquinolinone Length = 366 Back     alignment and structure
>pdb|4EWH|B Chain B, Co-Crystal Structure Of Ack1 With Inhibitor Length = 275 Back     alignment and structure
>pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 Back     alignment and structure
>pdb|3TG1|A Chain A, Crystal Structure Of P38alpha In Complex With A Mapk Docking Partner Length = 380 Back     alignment and structure
>pdb|2NPQ|A Chain A, A Novel Lipid Binding Site In The P38 Alpha Map Kinase Length = 367 Back     alignment and structure
>pdb|3OEF|X Chain X, Crystal Structure Of Y323f Inactive Mutant Of P38alpha Map Kinase Length = 360 Back     alignment and structure
>pdb|3ODY|X Chain X, Crystal Structure Of P38alpha Y323q Active Mutant Length = 360 Back     alignment and structure
>pdb|1DI9|A Chain A, The Structure Of P38 Mitogen-Activated Protein Kinase In Complex With 4-[3-Methylsulfanylanilino]-6,7- Dimethoxyquinazoline Length = 360 Back     alignment and structure
>pdb|3OD6|X Chain X, Crystal Structure Of P38alpha Y323t Active Mutant Length = 360 Back     alignment and structure
>pdb|3E92|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biaryl Amide Inhibitor Length = 371 Back     alignment and structure
>pdb|3HVC|A Chain A, Crystal Structure Of Human P38alpha Map Kinase Length = 362 Back     alignment and structure
>pdb|2FSO|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a) Activating Mutant Length = 367 Back     alignment and structure
>pdb|2FST|X Chain X, Mitogen Activated Protein Kinase P38alpha (d176a+f327l) Activating Mutant Length = 367 Back     alignment and structure
>pdb|3S3I|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 349 Back     alignment and structure
>pdb|3PY3|A Chain A, Crystal Structure Of Phosphorylated P38alpha Map Kinase Length = 380 Back     alignment and structure
>pdb|3GCU|A Chain A, Human P38 Map Kinase In Complex With Rl48 Length = 360 Back     alignment and structure
>pdb|4FUX|A Chain A, Crystal Structure Of The Erk2 Complexed With E75 Length = 360 Back     alignment and structure
>pdb|2OZA|B Chain B, Structure Of P38alpha Complex Length = 366 Back     alignment and structure
>pdb|4FV6|A Chain A, Crystal Structure Of The Erk2 Complexed With E57 Length = 360 Back     alignment and structure
>pdb|3RP9|A Chain A, Crystal Structure Of The Apo Mapk From Toxoplasma Gondii, 25.M01780 Or Tgme49_007820 Length = 458 Back     alignment and structure
>pdb|2FSL|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a+f327s) Activating Mutant Form-A Length = 367 Back     alignment and structure
>pdb|4GSB|A Chain A, Monoclinic Crystal Form Of The Apo-Erk2 Length = 364 Back     alignment and structure
>pdb|3HEC|A Chain A, P38 In Complex With Imatinib Length = 348 Back     alignment and structure
>pdb|4FV7|A Chain A, Crystal Structure Of The Erk2 Complexed With E94 Length = 360 Back     alignment and structure
>pdb|1ZZL|A Chain A, Crystal Structure Of P38 With Triazolopyridine Length = 351 Back     alignment and structure
>pdb|3DLS|A Chain A, Crystal Structure Of Human Pas Kinase Bound To Adp Length = 335 Back     alignment and structure
>pdb|3K3J|A Chain A, P38alpha Bound To Novel Dfg-Out Compound Pf-00416121 Length = 362 Back     alignment and structure
>pdb|3NNX|A Chain A, Crystal Structure Of Phosphorylated P38 Alpha In Complex With Dp802 Length = 354 Back     alignment and structure
>pdb|3QC9|A Chain A, Crystal Structure Of Cross-Linked Bovine Grk1 T8cN480C DOUBLE MUTANT Complexed With Adp And Mg Length = 543 Back     alignment and structure
>pdb|3QC9|A Chain A, Crystal Structure Of Cross-Linked Bovine Grk1 T8cN480C DOUBLE MUTANT Complexed With Adp And Mg Length = 543 Back     alignment and structure
>pdb|4E5A|X Chain X, The W197a Mutant Of P38a Map Kinase Length = 360 Back     alignment and structure
>pdb|4ID7|A Chain A, Ack1 Kinase In Complex With The Inhibitor Cis-3-[8-amino-1-(4- Phenoxyphenyl)imidazo[1,5-a]pyrazin-3-yl]cyclobutanol Length = 273 Back     alignment and structure
>pdb|3ZSG|A Chain A, X-Ray Structure Of P38alpha Bound To Tak-715 Length = 362 Back     alignment and structure
>pdb|3NNU|A Chain A, Crystal Structure Of P38 Alpha In Complex With Dp1376 Length = 354 Back     alignment and structure
>pdb|4EWQ|A Chain A, Human P38 Alpha Mapk In Complex With A Pyridazine Based Inhibitor Length = 383 Back     alignment and structure
>pdb|3K3I|A Chain A, P38alpha Bound To Novel Dgf-Out Compound Pf-00215955 Length = 350 Back     alignment and structure
>pdb|1OZ1|A Chain A, P38 Mitogen-Activated Kinase In Complex With 4-Azaindole Inhibitor Length = 372 Back     alignment and structure
>pdb|2GFS|A Chain A, P38 Kinase Crystal Structure In Complex With Ro3201195 Length = 372 Back     alignment and structure
>pdb|1M7Q|A Chain A, Crystal Structure Of P38 Map Kinase In Complex With A Dihydroquinazolinone Inhibitor Length = 366 Back     alignment and structure
>pdb|3OHT|A Chain A, Crystal Structure Of Salmo Salar P38alpha Length = 389 Back     alignment and structure
>pdb|3MPT|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Pyrrole-2- Carboxamide Inhibitor Length = 371 Back     alignment and structure
>pdb|1BL6|A Chain A, The Complex Structure Of The Map Kinase P38SB216995 Length = 379 Back     alignment and structure
>pdb|4HZR|A Chain A, Crystal Structure Of Ack1 Kinase Domain Length = 277 Back     alignment and structure
>pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 Back     alignment and structure
>pdb|3KQ7|A Chain A, Structure Of Human P38alpha With N-[4-Methyl-3-(6-{[2-(1- Methylpyrrolidin-2-Yl)ethyl]amino}pyridine-3- Amido)phenyl]- 2-(Morpholin-4-Yl)pyridine-4-Carboxamide Length = 380 Back     alignment and structure
>pdb|2LGC|A Chain A, Joint Nmr And X-Ray Refinement Reveals The Structure Of A Novel Dibenzo[a,D]cycloheptenone InhibitorP38 MAP KINASE COMPLEX IN Solution Length = 359 Back     alignment and structure
>pdb|2Y9Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|3DT1|A Chain A, P38 Complexed With A Quinazoline Inhibitor Length = 383 Back     alignment and structure
>pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 Back     alignment and structure
>pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 Back     alignment and structure
>pdb|4DN5|A Chain A, Crystal Structure Of Nf-kb-inducing Kinase (nik) Length = 356 Back     alignment and structure
>pdb|4DN5|A Chain A, Crystal Structure Of Nf-kb-inducing Kinase (nik) Length = 356 Back     alignment and structure
>pdb|3SA0|A Chain A, Complex Of Erk2 With Norathyriol Length = 360 Back     alignment and structure
>pdb|1IAN|A Chain A, Human P38 Map Kinase Inhibitor Complex Length = 366 Back     alignment and structure
>pdb|3EB0|A Chain A, Crystal Structure Of Cgd4_240 From Cryptosporidium Parvum In Complex With Indirubin E804 Length = 383 Back     alignment and structure
>pdb|1WZY|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Pyrazolopyridazine Derivative Length = 368 Back     alignment and structure
>pdb|1TVO|A Chain A, The Structure Of Erk2 In Complex With A Small Molecule Inhibitor Length = 368 Back     alignment and structure
>pdb|3QYW|A Chain A, Crystal Structure Of Erk2 In Complex With An Inhibitor Length = 364 Back     alignment and structure
>pdb|3QA8|A Chain A, Crystal Structure Of Inhibitor Of Kappa B Kinase Beta Length = 676 Back     alignment and structure
>pdb|3R63|A Chain A, Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 Back     alignment and structure
>pdb|3RZF|A Chain A, Crystal Structure Of Inhibitor Of Kappab Kinase Beta (I4122) Length = 677 Back     alignment and structure
>pdb|3ZU7|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|2Z7L|A Chain A, Unphosphorylated Mitogen Activated Protein Kinase Erk2 In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin 2-Yl]amino}phenyl)acetic Acid Length = 366 Back     alignment and structure
>pdb|3C9W|A Chain A, Crystal Structure Of Erk-2 With Hypothemycin Covalently Bound Length = 357 Back     alignment and structure
>pdb|2OJG|A Chain A, Crystal Structure Of Erk2 In Complex With N,n-dimethyl-4-(4- Phenyl-1h-pyrazol-3-yl)-1h-pyrrole-2-carboxamide Length = 380 Back     alignment and structure
>pdb|2FYS|B Chain B, Crystal Structure Of Erk2 Complex With Kim Peptide Derived From Mkp3 Length = 364 Back     alignment and structure
>pdb|3ZUV|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|2ERK|A Chain A, Phosphorylated Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|4G3D|A Chain A, Crystal Structure Of Human Nf-kappab Inducing Kinase (nik) Length = 371 Back     alignment and structure
>pdb|3O71|A Chain A, Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length = 358 Back     alignment and structure
>pdb|4H3Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 Back     alignment and structure
>pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 Back     alignment and structure
>pdb|3TEI|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|2GPH|A Chain A, Docking Motif Interactions In The Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|3NUP|A Chain A, Cdk6 (Monomeric) In Complex With Inhibitor Length = 307 Back     alignment and structure
>pdb|3NUP|A Chain A, Cdk6 (Monomeric) In Complex With Inhibitor Length = 307 Back     alignment and structure
>pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 Back     alignment and structure
>pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|3P1A|A Chain A, Structure Of Human Membrane-Associated Tyrosine- And Threonine- Specific Cdc2-Inhibitory Kinase Myt1 (Pkmyt1) Length = 311 Back     alignment and structure
>pdb|2IVV|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Complexed With The Inhibitor Pp1 Length = 314 Back     alignment and structure
>pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 Back     alignment and structure
>pdb|3MH2|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|2W96|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|3N9X|A Chain A, Crystal Structure Of Map Kinase From Plasmodium Berghei, Pb000659.00.0 Length = 432 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|2I6L|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 6 (Mapk6) Length = 320 Back     alignment and structure
>pdb|3GP0|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 11 (p38 Beta) In Complex With Nilotinib Length = 348 Back     alignment and structure
>pdb|4EUT|A Chain A, Structure Of Bx-795 Complexed With Unphosphorylated Human Tbk1 Kinase- Uld Domain Length = 396 Back     alignment and structure
>pdb|1GOL|A Chain A, Coordinates Of Rat Map Kinase Erk2 With An Arginine Mutation At Position 52 Length = 364 Back     alignment and structure
>pdb|4EUU|A Chain A, Structure Of Bx-795 Complexed With Human Tbk1 Kinase Domain Phosphorylated On Ser172 Length = 319 Back     alignment and structure
>pdb|2ZOQ|A Chain A, Structural Dissection Of Human Mitogen-Activated Kinase Erk1 Length = 382 Back     alignment and structure
>pdb|2I1M|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An Arylamide Inhibitor Length = 333 Back     alignment and structure
>pdb|3BEA|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A Pyrimidinopyridone Inhibitor Length = 333 Back     alignment and structure
>pdb|4ANM|A Chain A, Complex Of Ck2 With A Cdc7 Inhibitor Length = 335 Back     alignment and structure
>pdb|4ANM|A Chain A, Complex Of Ck2 With A Cdc7 Inhibitor Length = 335 Back     alignment and structure
>pdb|3GC9|A Chain A, The Structure Of P38beta C119s, C162s In Complex With A Dihydroquinazolinone Inhibitor Length = 370 Back     alignment and structure
>pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 Back     alignment and structure
>pdb|1DS5|A Chain A, Dimeric Crystal Structure Of The Alpha Subunit In Complex With Two Beta Peptides Mimicking The Architecture Of The Tetrameric Protein Kinase Ck2 Holoenzyme. Length = 332 Back     alignment and structure
>pdb|1DS5|A Chain A, Dimeric Crystal Structure Of The Alpha Subunit In Complex With Two Beta Peptides Mimicking The Architecture Of The Tetrameric Protein Kinase Ck2 Holoenzyme. Length = 332 Back     alignment and structure
>pdb|2QC6|A Chain A, Protein Kinase Ck2 In Complex With Dbc Length = 332 Back     alignment and structure
>pdb|2QC6|A Chain A, Protein Kinase Ck2 In Complex With Dbc Length = 332 Back     alignment and structure
>pdb|1DAW|A Chain A, Crystal Structure Of A Binary Complex Of Protein Kinase Ck2 (Alpha-Subunit) And Mg-Amppnp Length = 327 Back     alignment and structure
>pdb|1DAW|A Chain A, Crystal Structure Of A Binary Complex Of Protein Kinase Ck2 (Alpha-Subunit) And Mg-Amppnp Length = 327 Back     alignment and structure
>pdb|3PVG|A Chain A, Crystal Structure Of Z. Mays Ck2 Alpha Subunit In Complex With The Inhibitor 4,5,6,7-Tetrabromo-1-Carboxymethylbenzimidazole (K68) Length = 331 Back     alignment and structure
>pdb|3PVG|A Chain A, Crystal Structure Of Z. Mays Ck2 Alpha Subunit In Complex With The Inhibitor 4,5,6,7-Tetrabromo-1-Carboxymethylbenzimidazole (K68) Length = 331 Back     alignment and structure
>pdb|1M2P|A Chain A, Crystal Structure Of 1,8-Di-Hydroxy-4-Nitro- AnthraquinoneCK2 KINASE COMPLEX Length = 325 Back     alignment and structure
>pdb|1M2P|A Chain A, Crystal Structure Of 1,8-Di-Hydroxy-4-Nitro- AnthraquinoneCK2 KINASE COMPLEX Length = 325 Back     alignment and structure
>pdb|4DGN|A Chain A, Crystal Structure Of Maize Ck2 In Complex With The Inhibitor Luteolin Length = 326 Back     alignment and structure
>pdb|4DGN|A Chain A, Crystal Structure Of Maize Ck2 In Complex With The Inhibitor Luteolin Length = 326 Back     alignment and structure
>pdb|3GC8|A Chain A, The Structure Of P38beta C162s In Complex With A Dihydroquinazolinone Length = 370 Back     alignment and structure
>pdb|2W9F|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|3KXG|A Chain A, Crystal Structure Of Z. Mays Ck2 Kinase Alpha Subunit In Complex With The Inhibitor 3,4,5,6,7-Pentabromo-1h-Indazole (K64) Length = 327 Back     alignment and structure
>pdb|3KXG|A Chain A, Crystal Structure Of Z. Mays Ck2 Kinase Alpha Subunit In Complex With The Inhibitor 3,4,5,6,7-Pentabromo-1h-Indazole (K64) Length = 327 Back     alignment and structure
>pdb|2W99|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|4DGM|A Chain A, Crystal Structure Of Maize Ck2 In Complex With The Inhibitor Apigenin Length = 326 Back     alignment and structure
>pdb|4DGM|A Chain A, Crystal Structure Of Maize Ck2 In Complex With The Inhibitor Apigenin Length = 326 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|2PVH|A Chain A, Structure-Based Design Of Pyrazolo[1,5-A][1,3,5]triazine Derivatives As Potent Inhibitors Of Protein Kinase Ck2 Length = 352 Back     alignment and structure
>pdb|2PVH|A Chain A, Structure-Based Design Of Pyrazolo[1,5-A][1,3,5]triazine Derivatives As Potent Inhibitors Of Protein Kinase Ck2 Length = 352 Back     alignment and structure
>pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 Back     alignment and structure
>pdb|3O8P|A Chain A, Conformational Plasticity Of P38 Map Kinase Dfg Motif Mutants In Response To Inhibitor Binding Length = 360 Back     alignment and structure
>pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 Back     alignment and structure
>pdb|1RJB|A Chain A, Crystal Structure Of Flt3 Length = 344 Back     alignment and structure
>pdb|3GI3|A Chain A, Crystal Structure Of A N-Phenyl-N'-Naphthylurea Analog In Complex With P38 Map Kinase Length = 360 Back     alignment and structure
>pdb|2IVT|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|3OFM|A Chain A, Structure Of A Human Ck2alpha Prime, The Paralog Isoform Of The Catalytic Subunit Of Protein Kinase Ck2 From Homo Sapiens Length = 350 Back     alignment and structure
>pdb|2IVS|A Chain A, Crystal Structure Of Non-Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|3E3B|X Chain X, Crystal Structure Of Catalytic Subunit Of Human Protein Kinase Ck2alpha Prime With A Potent Indazole-Derivative Inhibitor Length = 339 Back     alignment and structure
>pdb|2P2H|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridinyl-Triazine Inhibitor Length = 314 Back     alignment and structure
>pdb|2P2I|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Nicotinamide Inhibitor Length = 314 Back     alignment and structure
>pdb|3MH0|A Chain A, Mutagenesis Of P38 Map Kinase Eshtablishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3VID|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With Compound A Length = 356 Back     alignment and structure
>pdb|3JUH|A Chain A, Crystal Structure Of A Mutant Of Human Protein Kinase Ck2alpha With Altered Cosubstrate Specificity Length = 335 Back     alignment and structure
>pdb|3VHK|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Back Pocket Binder Length = 368 Back     alignment and structure
>pdb|3P23|A Chain A, Crystal Structure Of The Human Kinase And Rnase Domains In Complex With Adp Length = 432 Back     alignment and structure
>pdb|3P23|A Chain A, Crystal Structure Of The Human Kinase And Rnase Domains In Complex With Adp Length = 432 Back     alignment and structure
>pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 Back     alignment and structure
>pdb|1Y6A|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 2-Anilino-5-Aryl-Oxazole Inhibitor Length = 366 Back     alignment and structure
>pdb|3VHE|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With A Novel Pyrrolopyrimidine Inhibitor Length = 359 Back     alignment and structure
>pdb|3C7Q|A Chain A, Structure Of Vegfr2 Kinase Domain In Complex With Bibf1120 Length = 316 Back     alignment and structure
>pdb|2OH4|A Chain A, Crystal Structure Of Vegfr2 With A Benzimidazole-Urea Inhibitor Length = 316 Back     alignment and structure
>pdb|1YWN|A Chain A, Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]pyrimidine Length = 316 Back     alignment and structure
>pdb|3MH3|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|2R7I|A Chain A, Crystal Structure Of Catalytic Subunit Of Protein Kinase Ck2 Length = 335 Back     alignment and structure
>pdb|3EWH|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridyl-Pyrimidine Benzimidazole Inhibitor Length = 314 Back     alignment and structure
>pdb|3Q9W|A Chain A, Crystal Structure Of Human Ck2 Alpha In Complex With Emodin At Ph 8.5 Length = 336 Back     alignment and structure
>pdb|3MH1|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3NGA|A Chain A, Human Ck2 Catalytic Domain In Complex With Cx-4945 Length = 333 Back     alignment and structure
>pdb|3LLT|A Chain A, Crystal Structure Of Pf14_0431, Kinase Domain Length = 360 Back     alignment and structure
>pdb|3H30|A Chain A, Crystal Structure Of The Catalytic Subunit Of Human Protein Kinase Ck2 With 5,6-Dichloro-1-Beta-D- Ribofuranosylbenzimidazole Length = 334 Back     alignment and structure
>pdb|3NSZ|A Chain A, Human Ck2 Catalytic Domain In Complex With Amppn Length = 330 Back     alignment and structure
>pdb|3BQC|A Chain A, High Ph-Value Crystal Structure Of Emodin In Complex With The Catalytic Subunit Of Protein Kinase Ck2 Length = 335 Back     alignment and structure
>pdb|1PJK|A Chain A, Crystal Structure Of A C-terminal Deletion Mutant Of Human Protein Kinase Ck2 Catalytic Subunit Length = 334 Back     alignment and structure
>pdb|3Q04|A Chain A, Crystal Structure Of The Apo-Form Of Human Ck2 Alpha At Ph 8.5 Length = 328 Back     alignment and structure
>pdb|1JWH|A Chain A, Crystal Structure Of Human Protein Kinase Ck2 Holoenzyme Length = 337 Back     alignment and structure
>pdb|4DGL|C Chain C, Crystal Structure Of The Ck2 Tetrameric Holoenzyme Length = 335 Back     alignment and structure
>pdb|3U6J|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyrazolone Inhibitor Length = 314 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1310
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 2e-55
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 5e-29
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 6e-22
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 1e-17
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 2e-14
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 2e-11
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 4e-52
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 2e-28
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 3e-21
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 3e-17
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 8e-11
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 1e-08
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 1e-51
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 3e-29
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 2e-20
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 3e-17
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 3e-12
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 2e-09
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 5e-51
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-28
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 2e-21
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-16
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 8e-13
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-10
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-06
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 1e-50
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 4e-28
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 5e-22
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 3e-17
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 1e-11
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 2e-11
2y0a_A326 Death-associated protein kinase 1; transferase, ca 6e-50
2y0a_A326 Death-associated protein kinase 1; transferase, ca 4e-28
2y0a_A326 Death-associated protein kinase 1; transferase, ca 3e-22
2y0a_A326 Death-associated protein kinase 1; transferase, ca 8e-17
2y0a_A326 Death-associated protein kinase 1; transferase, ca 3e-11
2y0a_A326 Death-associated protein kinase 1; transferase, ca 4e-11
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 9e-50
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 7e-28
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 6e-22
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 1e-16
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 2e-11
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 4e-11
3bhy_A283 Death-associated protein kinase 3; death associate 8e-49
3bhy_A283 Death-associated protein kinase 3; death associate 4e-28
3bhy_A283 Death-associated protein kinase 3; death associate 4e-21
3bhy_A283 Death-associated protein kinase 3; death associate 5e-17
3bhy_A283 Death-associated protein kinase 3; death associate 2e-10
3bhy_A283 Death-associated protein kinase 3; death associate 5e-10
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 7e-43
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 2e-18
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 8e-15
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 3e-13
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 5e-08
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 1e-07
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 6e-42
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 1e-16
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 1e-12
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 4e-11
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 6e-10
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 7e-08
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 9e-42
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 2e-19
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 2e-13
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 4e-13
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 3e-09
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 1e-07
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 2e-41
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 1e-27
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 6e-22
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 2e-13
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 5e-08
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 1e-06
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 5e-41
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 2e-19
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 1e-15
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 9e-13
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 2e-08
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 1e-07
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 6e-41
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 3e-17
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 1e-12
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 1e-12
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 6e-09
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 1e-06
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 1e-40
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 2e-18
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 6e-14
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 3e-11
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 9e-09
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 9e-09
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 3e-40
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 1e-18
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 1e-14
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 2e-12
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 4e-08
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 1e-07
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 3e-40
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 1e-17
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 1e-12
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 2e-12
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 2e-09
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 1e-06
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 7e-40
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 5e-18
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 7e-15
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 5e-12
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 2e-10
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 1e-07
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 8e-40
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 6e-21
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 1e-15
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 2e-10
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 3e-08
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 8e-08
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 2e-39
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 7e-19
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 5e-15
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 8e-12
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 4e-11
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 2e-07
3lij_A494 Calcium/calmodulin dependent protein kinase with A 3e-39
3lij_A494 Calcium/calmodulin dependent protein kinase with A 8e-19
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 6e-15
3lij_A494 Calcium/calmodulin dependent protein kinase with A 1e-11
3lij_A494 Calcium/calmodulin dependent protein kinase with A 5e-11
3lij_A494 Calcium/calmodulin dependent protein kinase with A 1e-07
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 1e-38
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 1e-18
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 1e-15
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 1e-11
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 4e-10
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 1e-07
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 2e-38
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 2e-15
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 2e-12
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 2e-10
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 6e-08
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 6e-07
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 2e-38
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 1e-15
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 6e-13
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 6e-07
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 1e-05
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 2e-05
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 7e-38
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 6e-17
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 1e-11
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 2e-11
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 1e-07
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 4e-07
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 3e-37
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 1e-14
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 8e-12
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 4e-10
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 8e-09
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 3e-06
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 4e-37
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 3e-16
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 2e-13
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 1e-09
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 1e-06
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 2e-05
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 7e-37
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 1e-14
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 9e-12
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 3e-10
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 1e-08
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 4e-06
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 3e-36
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 3e-15
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 6e-11
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 5e-10
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 3e-07
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 6e-07
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 4e-36
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 1e-22
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 4e-15
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 8e-12
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 1e-11
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 3e-08
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 4e-34
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 6e-17
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 3e-11
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 5e-10
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 3e-08
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 1e-06
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 8e-33
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 2e-15
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 3e-11
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 3e-10
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 1e-08
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 2e-04
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 3e-31
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 3e-11
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 1e-09
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 1e-08
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 2e-07
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 3e-05
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 3e-31
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 1e-14
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 2e-10
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 1e-09
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 5e-09
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 4e-04
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 4e-31
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 8e-17
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 5e-11
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 1e-09
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 8e-07
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 7e-05
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 1e-29
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 1e-15
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 4e-13
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 4e-11
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 9e-06
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 2e-29
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 1e-15
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 5e-13
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 4e-11
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 2e-04
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 5e-29
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 3e-14
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 7e-12
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 2e-11
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 8e-04
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 1e-28
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 7e-15
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 2e-12
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 1e-09
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 4e-28
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 5e-15
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 2e-12
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 2e-10
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 4e-28
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 1e-12
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 1e-09
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 5e-09
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 1e-07
3qa8_A676 MGC80376 protein; kinase ubiquitin-like domain, ph 4e-28
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 2e-15
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 2e-11
3qa8_A676 MGC80376 protein; kinase ubiquitin-like domain, ph 5e-10
3qa8_A676 MGC80376 protein; kinase ubiquitin-like domain, ph 1e-07
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 6e-28
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 8e-11
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 1e-09
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 3e-09
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 8e-08
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 2e-27
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 2e-12
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 2e-09
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 6e-09
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 2e-07
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 3e-27
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 4e-11
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 7e-10
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 2e-07
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 2e-26
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 2e-14
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 4e-10
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 5e-10
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 5e-26
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 9e-09
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 2e-08
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 6e-26
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 2e-12
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 3e-09
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 2e-08
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 1e-06
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 7e-26
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 2e-14
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 2e-07
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 8e-06
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 4e-05
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 8e-26
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 2e-10
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 2e-08
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 3e-07
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 9e-26
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 3e-10
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 9e-09
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 1e-06
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 1e-05
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 6e-25
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 3e-09
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 1e-04
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 1e-24
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 2e-08
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 2e-06
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 5e-06
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 1e-04
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 2e-24
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 7e-11
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 1e-08
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 5e-07
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 3e-24
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 1e-14
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 1e-10
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 3e-07
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 1e-04
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 3e-24
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 2e-15
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 2e-12
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 4e-08
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 3e-24
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 2e-09
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 3e-04
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 7e-04
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 2e-23
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 8e-13
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 3e-10
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 1e-07
2a19_B284 Interferon-induced, double-stranded RNA-activated 2e-23
2a19_B284 Interferon-induced, double-stranded RNA-activated 1e-09
2a19_B284 Interferon-induced, double-stranded RNA-activated 7e-08
2a19_B284 Interferon-induced, double-stranded RNA-activated 5e-05
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 3e-23
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 2e-10
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 2e-08
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 1e-06
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 4e-23
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 3e-09
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 3e-07
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 2e-06
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 5e-06
3dls_A335 PAS domain-containing serine/threonine-protein KI; 4e-23
3dls_A335 PAS domain-containing serine/threonine-protein KI; 3e-12
3dls_A335 PAS domain-containing serine/threonine-protein KI; 1e-08
3dls_A335 PAS domain-containing serine/threonine-protein KI; 8e-08
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 2e-22
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 6e-13
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 5e-10
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 2e-06
2eue_A275 Carbon catabolite derepressing protein kinase; kin 3e-22
2eue_A275 Carbon catabolite derepressing protein kinase; kin 8e-13
2eue_A275 Carbon catabolite derepressing protein kinase; kin 3e-10
2eue_A275 Carbon catabolite derepressing protein kinase; kin 2e-07
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 5e-22
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 1e-10
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 8e-10
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 5e-06
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 2e-04
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 6e-22
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 9e-07
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 1e-04
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 1e-04
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 6e-22
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 2e-11
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 7e-10
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 4e-06
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 7e-22
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 9e-08
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 1e-06
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 1e-21
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 2e-06
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 9e-05
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 1e-21
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 1e-07
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 1e-04
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 6e-04
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 1e-21
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 5e-09
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 1e-05
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 3e-05
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 1e-21
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 1e-11
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 2e-09
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 2e-06
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 2e-21
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 4e-06
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 9e-04
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 3e-21
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 3e-12
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 9e-10
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 4e-07
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 3e-21
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 3e-08
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 7e-08
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 2e-05
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 1e-20
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 2e-13
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 4e-09
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 1e-06
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 6e-20
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 1e-13
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 2e-09
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 1e-04
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 1e-19
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 2e-08
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 4e-05
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 1e-19
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 1e-08
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 5e-08
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 1e-05
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 3e-19
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 3e-06
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 1e-05
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 3e-19
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 3e-13
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 3e-09
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 8e-05
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 5e-19
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 7e-07
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 7e-06
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 5e-19
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 2e-08
3eqc_A360 Dual specificity mitogen-activated protein kinase; 3e-18
3eqc_A360 Dual specificity mitogen-activated protein kinase; 4e-07
3eqc_A360 Dual specificity mitogen-activated protein kinase; 1e-04
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 4e-18
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 6e-08
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 4e-05
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 2e-04
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 4e-18
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 1e-14
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 1e-07
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 6e-07
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 3e-05
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 3e-17
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 4e-15
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 3e-08
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 2e-07
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 3e-04
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 4e-16
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 5e-06
3pvu_A695 Beta-adrenergic receptor kinase 1; transferase, se 7e-16
3pvu_A695 Beta-adrenergic receptor kinase 1; transferase, se 7e-08
3pvu_A695 Beta-adrenergic receptor kinase 1; transferase, se 2e-06
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-08
2dyl_A318 Dual specificity mitogen-activated protein kinase 8e-16
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 1e-15
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 8e-13
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 1e-04
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 3e-04
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 2e-15
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 6e-09
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 9e-07
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 3e-04
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 3e-15
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 4e-15
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 3e-08
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 1e-06
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 4e-15
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 8e-08
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 2e-07
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 2e-05
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 4e-15
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 2e-06
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 3e-06
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 9e-15
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 2e-13
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 2e-06
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 1e-05
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 1e-14
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 1e-14
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 2e-05
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 1e-14
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 2e-11
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 3e-08
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 2e-04
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 2e-14
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 4e-10
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 1e-06
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 2e-04
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 2e-14
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 3e-04
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 2e-14
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 4e-09
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 3e-06
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 4e-05
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 3e-14
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 4e-06
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 4e-14
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 2e-05
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 4e-14
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 7e-05
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 7e-14
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 1e-10
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 2e-07
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 3e-06
3aln_A327 Dual specificity mitogen-activated protein kinase; 1e-13
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 1e-13
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 2e-06
3an0_A340 Dual specificity mitogen-activated protein kinase; 2e-13
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 2e-13
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 5e-09
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 4e-07
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 1e-05
3fme_A290 Dual specificity mitogen-activated protein kinase; 3e-13
3fme_A290 Dual specificity mitogen-activated protein kinase; 6e-04
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 3e-13
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 9e-09
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 1e-07
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 2e-06
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 3e-13
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 1e-05
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 3e-13
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 6e-06
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 7e-05
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 7e-04
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 5e-13
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 2e-05
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 9e-13
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 2e-11
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 1e-07
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 2e-05
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 1e-12
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 3e-05
3o0g_A292 Cell division protein kinase 5; kinase activator c 1e-12
3o0g_A292 Cell division protein kinase 5; kinase activator c 2e-05
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 1e-12
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 1e-09
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 8e-06
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 1e-05
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 2e-12
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 3e-05
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 2e-12
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 5e-10
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 2e-12
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 1e-10
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 4e-07
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 6e-06
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 2e-12
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 2e-09
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 1e-05
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 2e-05
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 2e-12
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 3e-12
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 9e-11
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 2e-07
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 2e-05
3lzb_A327 Epidermal growth factor receptor; epidermal growth 3e-12
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 3e-12
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 4e-06
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 3e-12
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 4e-12
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 5e-06
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 4e-12
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 1e-04
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 1e-11
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 9e-09
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 1e-07
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 1e-06
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 1e-11
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 1e-10
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 2e-07
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 3e-05
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 1e-11
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 3e-05
2fst_X367 Mitogen-activated protein kinase 14; active mutant 1e-11
2fst_X367 Mitogen-activated protein kinase 14; active mutant 1e-04
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 2e-11
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 9e-06
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 2e-11
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 1e-04
3rp9_A458 Mitogen-activated protein kinase; structural genom 2e-11
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 2e-11
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 3e-06
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 5e-06
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 9e-05
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 2e-11
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 3e-09
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 2e-07
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 1e-05
3niz_A311 Rhodanese family protein; structural genomics, str 4e-11
3niz_A311 Rhodanese family protein; structural genomics, str 1e-05
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 4e-11
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 5e-11
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 4e-04
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 5e-11
3poz_A327 Epidermal growth factor receptor; kinase domain, a 7e-11
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 8e-11
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 2e-04
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 8e-11
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 8e-11
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 9e-08
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 9e-11
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 1e-10
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 1e-05
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 1e-10
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 2e-05
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 1e-10
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 2e-10
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 2e-10
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 2e-10
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 3e-10
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 3e-10
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 4e-10
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 4e-10
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 4e-10
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 5e-10
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 5e-10
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 6e-10
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 6e-10
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 6e-10
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 6e-10
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 7e-10
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 7e-10
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 9e-06
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 7e-10
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 8e-10
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 8e-10
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 8e-10
3uqc_A286 Probable conserved transmembrane protein; structur 1e-09
3uqc_A286 Probable conserved transmembrane protein; structur 1e-06
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 1e-09
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 1e-09
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 1e-09
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 2e-09
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 2e-09
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 2e-09
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 3e-09
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 3e-09
3ork_A311 Serine/threonine protein kinase; structural genomi 4e-09
3ork_A311 Serine/threonine protein kinase; structural genomi 4e-07
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 4e-09
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 4e-09
3q4u_A301 Activin receptor type-1; structural genomics conso 5e-09
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 5e-09
3soc_A322 Activin receptor type-2A; structural genomics cons 5e-09
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 6e-09
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 1e-08
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 1e-08
3pls_A298 Macrophage-stimulating protein receptor; protein k 2e-08
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 2e-08
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 2e-08
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 2e-08
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 2e-08
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 2e-08
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 3e-08
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 3e-08
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 3e-08
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 4e-08
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 5e-08
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 8e-07
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 3e-05
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 1e-04
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 2e-04
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 5e-08
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 7e-08
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 1e-07
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 8e-08
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 9e-08
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 1e-07
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 1e-07
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 4e-07
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 2e-07
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 2e-07
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 4e-06
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 2e-07
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 3e-07
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 3e-07
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 3e-07
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 4e-07
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 4e-07
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 8e-06
3b43_A 570 Titin; I-SET IG fold, extended poly-IG filament, e 6e-05
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 1e-04
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 8e-04
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 4e-07
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 4e-07
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 5e-07
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 6e-07
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 8e-07
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 9e-07
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 3e-06
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 9e-07
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 4e-06
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 9e-07
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 3e-05
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 1e-06
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 1e-06
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 1e-06
2ens_A96 Advanced glycosylation END product-specific recept 1e-06
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 1e-06
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 1e-05
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 1e-06
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 1e-06
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 1e-06
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 1e-06
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 2e-06
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 2e-06
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 2e-06
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 2e-06
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 2e-06
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 1e-04
2crz_A110 Fibronectin type-III domain containing protein 3A; 2e-06
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 2e-06
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 2e-06
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 3e-06
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 3e-06
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 3e-05
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 3e-06
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 3e-06
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 3e-06
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 3e-06
1x5x_A109 Fibronectin type-III domain containing protein 3A; 4e-06
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 4e-06
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 4e-06
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 4e-06
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 4e-06
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 5e-06
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 4e-04
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 5e-06
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 5e-06
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 3e-05
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 6e-06
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 6e-06
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 1e-05
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 6e-06
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 6e-06
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 6e-05
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 7e-05
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 6e-06
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 6e-06
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 7e-06
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 7e-06
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 1e-04
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 7e-06
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 8e-06
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 9e-06
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 9e-06
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 1e-05
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 1e-05
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 2e-05
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 1e-05
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 1e-05
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 4e-05
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 1e-05
4aoj_A329 High affinity nerve growth factor receptor; transf 1e-05
1x3d_A118 Fibronectin type-III domain containing protein 3A; 2e-05
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 2e-05
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 2e-05
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 2e-05
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 3e-04
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 2e-05
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 4e-04
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 2e-05
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 3e-04
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 3e-05
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 6e-04
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 3e-05
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 3e-05
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 3e-05
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 1e-04
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 3e-05
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 3e-05
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 3e-05
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 3e-05
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 3e-04
2v9t_A117 Roundabout homolog 1; structural protein-receptor 3e-05
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 3e-05
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 3e-05
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 4e-05
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 4e-05
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 4e-05
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 9e-05
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 6e-04
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 4e-05
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 1e-04
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 5e-05
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 5e-05
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 6e-05
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 6e-05
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 7e-05
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 1e-04
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 8e-05
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 9e-05
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 2e-04
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 7e-04
2xir_A316 Vascular endothelial growth factor receptor 2; ang 9e-05
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 9e-05
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 3e-04
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 9e-05
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 1e-04
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 2e-04
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 1e-04
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 1e-04
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 1e-04
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 1e-04
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 1e-04
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 1e-04
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 1e-04
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 1e-04
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 1e-04
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 1e-04
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 2e-04
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 2e-04
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 2e-04
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 2e-04
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 2e-04
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 2e-04
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 3e-04
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 3e-04
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 3e-04
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 3e-04
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 3e-04
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 3e-04
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 3e-04
3mjg_X289 Beta-type platelet-derived growth factor receptor; 4e-04
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 4e-04
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 5e-04
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 7e-04
1x4x_A106 Fibronectin type-III domain containing protein 3A; 7e-04
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 8e-04
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
 Score =  197 bits (502), Expect = 2e-55
 Identities = 56/177 (31%), Positives = 93/177 (52%), Gaps = 1/177 (0%)

Query: 157 EDNENEYSYRTYARGRQVKTRTKPITDAYDFGDELGRGVTGIVYHAVERSSGRNYAAKVM 216
           + ++           + V+ +   + D YD  +ELG G  G+V+  VE+++GR + AK +
Sbjct: 25  DYDKFYEDIWKKYVPQPVEVKQGSVYDYYDILEELGSGAFGVVHRCVEKATGRVFVAKFI 84

Query: 217 TGKGNQYKSLFKNELDIMNQLCHRNLVRLHDSYETKDSFTIISELAGGGELLHSLTRQSY 276
                  K   KNE+ IMNQL H  L+ LHD++E K    +I E   GGEL   +  + Y
Sbjct: 85  NTPYPLDKYTVKNEISIMNQLHHPKLINLHDAFEDKYEMVLILEFLSGGELFDRIAAEDY 144

Query: 277 -YTEYDIAHYIRQLLSGLDYMHRLSIAHLGLTPGDLLVAHPGGRHLLLTDFGLSRRI 332
             +E ++ +Y+RQ   GL +MH  SI HL + P +++        + + DFGL+ ++
Sbjct: 145 KMSEAEVINYMRQACEGLKHMHEHSIVHLDIKPENIMCETKKASSVKIIDFGLATKL 201


>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Length = 299 Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Length = 299 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Length = 298 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Length = 330 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Length = 296 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Length = 345 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Length = 345 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1310
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 100.0
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 100.0
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 100.0
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 100.0
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 100.0
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 100.0
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 100.0
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 100.0
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 100.0
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 100.0
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 100.0
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 100.0
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 100.0
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 100.0
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 100.0
3lij_A494 Calcium/calmodulin dependent protein kinase with A 100.0
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 100.0
2y0a_A326 Death-associated protein kinase 1; transferase, ca 100.0
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 100.0
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 100.0
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 100.0
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 100.0
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 100.0
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 100.0
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 100.0
4aoj_A329 High affinity nerve growth factor receptor; transf 100.0
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 100.0
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 100.0
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 100.0
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 100.0
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 100.0
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 100.0
4ase_A353 Vascular endothelial growth factor receptor 2; tra 100.0
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 100.0
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 100.0
3niz_A311 Rhodanese family protein; structural genomics, str 100.0
3rp9_A458 Mitogen-activated protein kinase; structural genom 100.0
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 100.0
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 100.0
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 100.0
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 100.0
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 100.0
3o0g_A292 Cell division protein kinase 5; kinase activator c 100.0
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 100.0
4aoj_A329 High affinity nerve growth factor receptor; transf 100.0
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 100.0
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 100.0
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 100.0
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 100.0
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 100.0
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 100.0
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 100.0
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 100.0
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 100.0
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 100.0
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 100.0
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 100.0
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 100.0
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 100.0
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 100.0
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 100.0
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 100.0
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.98
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 99.98
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.98
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.98
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.98
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 99.98
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 99.98
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.98
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.98
2fst_X367 Mitogen-activated protein kinase 14; active mutant 99.98
2eue_A275 Carbon catabolite derepressing protein kinase; kin 99.98
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 99.98
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.98
4ase_A353 Vascular endothelial growth factor receptor 2; tra 99.98
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 99.98
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 99.97
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 99.97
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.97
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 99.97
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.97
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.97
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 99.97
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 99.97
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 99.97
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 99.97
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 99.97
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 99.97
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 99.97
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.97
2y0a_A326 Death-associated protein kinase 1; transferase, ca 99.97
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 99.97
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.97
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 99.97
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.97
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 99.97
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.97
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.97
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.97
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 99.97
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 99.97
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 99.97
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 99.97
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 99.97
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.97
3bhy_A283 Death-associated protein kinase 3; death associate 99.97
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.97
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 99.97
3eqc_A360 Dual specificity mitogen-activated protein kinase; 99.97
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.97
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 99.97
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 99.97
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 99.97
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.97
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 99.97
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 99.97
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 99.97
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 99.97
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 99.97
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 99.97
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 99.97
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 99.97
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.97
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.97
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.97
3o0g_A292 Cell division protein kinase 5; kinase activator c 99.97
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.97
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.97
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.97
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 99.97
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.97
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.97
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 99.97
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 99.97
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 99.97
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.97
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.97
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 99.97
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 99.97
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.97
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 99.97
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 99.97
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.97
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 99.97
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.97
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.97
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.97
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 99.97
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.97
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 99.97
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.97
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.97
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.97
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 99.97
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 99.97
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.97
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 99.97
3dls_A335 PAS domain-containing serine/threonine-protein KI; 99.97
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 99.97
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.97
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 99.97
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.97
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.97
3rp9_A458 Mitogen-activated protein kinase; structural genom 99.97
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 99.97
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.97
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.97
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 99.97
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.97
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 99.97
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 99.97
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 99.97
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 99.97
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 99.97
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.97
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 99.97
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 99.97
3niz_A311 Rhodanese family protein; structural genomics, str 99.96
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.96
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 99.96
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 99.96
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 99.96
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 99.96
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 99.96
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 99.96
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.96
3dls_A335 PAS domain-containing serine/threonine-protein KI; 99.96
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 99.96
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 99.96
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.96
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.96
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 99.96
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.96
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.96
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.96
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.96
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.96
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 99.96
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 99.96
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.96
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.96
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 99.96
3bhy_A283 Death-associated protein kinase 3; death associate 99.96
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 99.96
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.96
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.96
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.96
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 99.96
3ork_A311 Serine/threonine protein kinase; structural genomi 99.96
2eue_A275 Carbon catabolite derepressing protein kinase; kin 99.96
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.96
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 99.96
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.96
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.96
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.96
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.96
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 99.96
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 99.96
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.96
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.96
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 99.96
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.96
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.96
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.96
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.96
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.96
3soc_A322 Activin receptor type-2A; structural genomics cons 99.96
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 99.96
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.96
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 99.96
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 99.96
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.96
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 99.96
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 99.96
3ork_A311 Serine/threonine protein kinase; structural genomi 99.96
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.96
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.96
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 99.96
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 99.96
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.96
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.96
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 99.95
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 99.95
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.95
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 99.95
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 99.95
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.95
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.95
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.95
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.95
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.95
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.95
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.95
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.95
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 99.95
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.95
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 99.95
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.95
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.95
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.95
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.95
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.95
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 99.95
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.95
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 99.95
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 99.95
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.95
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 99.95
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.95
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.95
2fst_X367 Mitogen-activated protein kinase 14; active mutant 99.95
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.95
3eqc_A360 Dual specificity mitogen-activated protein kinase; 99.95
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 99.95
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.95
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.95
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.95
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 99.95
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.95
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.95
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 99.95
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.95
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 99.95
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.95
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.95
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 99.95
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.95
3an0_A340 Dual specificity mitogen-activated protein kinase; 99.95
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.95
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 99.95
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.95
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.95
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.95
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 99.95
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.95
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.95
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.95
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.95
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.95
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.95
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.95
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 99.95
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 99.95
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 99.95
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 99.95
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 99.95
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.95
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.95
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.95
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.95
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.95
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 99.95
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.95
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.95
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 99.95
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.95
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.95
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.95
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.94
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.94
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.94
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.94
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 99.94
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.94
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.94
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.94
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 99.94
3an0_A340 Dual specificity mitogen-activated protein kinase; 99.94
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.94
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.94
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 99.94
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 99.94
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.94
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.94
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.94
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 99.94
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.94
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.94
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.94
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 99.94
3soc_A322 Activin receptor type-2A; structural genomics cons 99.94
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.94
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.94
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.94
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 99.94
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.94
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.94
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.94
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.94
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.94
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.94
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 99.94
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.94
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.94
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.94
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.94
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.94
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.94
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.94
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.94
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.94
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.94
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.94
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.94
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.94
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.94
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.94
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.94
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.94
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.94
3q4u_A301 Activin receptor type-1; structural genomics conso 99.94
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.94
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.94
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.94
3poz_A327 Epidermal growth factor receptor; kinase domain, a 99.94
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.94
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.94
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.94
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.94
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.94
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.94
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.94
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.94
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.94
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.94
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.94
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.94
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.94
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.94
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.93
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 99.93
3poz_A327 Epidermal growth factor receptor; kinase domain, a 99.93
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.93
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.93
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.93
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.93
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.93
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.93
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.93
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.93
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.93
3lzb_A327 Epidermal growth factor receptor; epidermal growth 99.93
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 99.93
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.93
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.93
3uqc_A286 Probable conserved transmembrane protein; structur 99.93
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.93
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.93
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.93
3q4u_A301 Activin receptor type-1; structural genomics conso 99.93
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 99.93
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.93
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.93
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.93
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.93
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.93
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.93
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.93
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.93
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.93
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.93
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.93
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.93
3lzb_A327 Epidermal growth factor receptor; epidermal growth 99.93
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.93
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.93
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.93
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.93
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.93
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.93
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.93
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.93
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 99.93
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.93
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.93
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.93
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.93
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.93
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.93
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.93
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.93
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.93
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.93
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.93
3qa8_A676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.93
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.93
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.92
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.92
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.92
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.92
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.92
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.92
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.92
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.92
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.92
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.92
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.92
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.92
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.92
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.92
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.92
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 99.92
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.92
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.92
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.92
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.92
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.92
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.92
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 99.92
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.92
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.92
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.91
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 99.91
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.91
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.91
3uqc_A286 Probable conserved transmembrane protein; structur 99.91
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.91
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.9
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.9
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
Probab=100.00  E-value=8.9e-46  Score=450.59  Aligned_cols=377  Identities=20%  Similarity=0.266  Sum_probs=261.8

Q ss_pred             EEEEEecCCCCcccccccccccccccCCCcccccccccccCCcceeEEEEEEeccCCCceeEEEecccccceeeEEEeee
Q psy5279          27 VTVHVEDNENEYSYRTYARGRQVKTRTKPITDAYDFGDELGRGVTGIVYHAVERSSGRNYAAKVMTGKGTISHSVTVHVE  106 (1310)
Q Consensus        27 ~s~~v~~~p~pp~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~g~~G~v~~~~~~~~g~~~~~k~~~~~~~~S~s~t~~~~  106 (1310)
                      +.|+++.+|+||.. |.+  ..+ +.++..++|--+.+++|+.++||++|.++.+++  .|.++..   +..+.+++..+
T Consensus         2 ~~v~~~~~P~pP~~-P~v--~~~-~~~sv~L~W~~P~~DGgs~I~~Y~vE~~~~~~~--~W~~v~~---~~~t~~~V~~L   72 (573)
T 3uto_A            2 AMVADVPEPEPPRF-PII--ENI-LDEAVILSWKPPALDGGSLVTNYTIEKREAMGG--SWSPCAK---SRYTYTTIEGL   72 (573)
T ss_dssp             ------CCCCCCEE-EEE--EEE-CSSCEEEEEECCSCCSSSCCCEEEEEEEESSSC--CCEEEEE---ESSSEEEECCC
T ss_pred             CccccCCCCccCCC-CEE--EEe-eCCEEEEEECCCCcCCCCcccEEEEEEEECCCC--ceEEecc---ccCCEEEeCCC
Confidence            45677778888854 445  234 566667888888899999999999999987654  3444432   34566899999


Q ss_pred             cCCceeEEEEeecCccccccCCccccccccCCccccc-cccceecee-EEee----ecCcccccc--hhcccccceeccc
Q psy5279         107 DNENEYSYRTYARGRQVKTRTKPITDAYDFGDELGRG-VTGTISHSV-TVHV----EDNENEYSY--RTYARGRQVKTRT  178 (1310)
Q Consensus       107 ~~~~~y~frt~~~n~~~~~~~~~~~~~~~~g~~iG~G-~~g~is~~~-~i~v----~~~~~~~s~--~~~~~~~~~~~~~  178 (1310)
                      .+...|.|||+|.|..+.+.+...+......+..... ......... ....    .........  .............
T Consensus        73 ~~g~~Y~FRV~A~N~~G~s~PS~~s~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  152 (573)
T 3uto_A           73 RAGKQYEFRIIAENKHGQSKPCEPTAPVLIPGDERKRRRGYDVDEQGKIVRGKGTVSSNYDNYVFDIWKQYYPQPVEIKH  152 (573)
T ss_dssp             CTTCEEEEEEEEEETTEECCCCCCCCCEECC-------CCCEECSSSCEECCCCCCCSCGGGGCCCHHHHCCCCCCCCBS
T ss_pred             CCCCcEeEEEEEEcCceEcCCcCCCCCEEcCCCCcccccccccccccccccccccccccccccccccccccCCcccccCC
Confidence            9999999999999987766554433332211110000 000000000 0000    000000000  0000011112223


Q ss_pred             CccCCCeeeeceecccCceEEEEEEEcCCCcEEEEEEEecCCcchHHHHHHHHHHHHhcCCCCcceEEEEEEeCCeEEEE
Q psy5279         179 KPITDAYDFGDELGRGVTGIVYHAVERSSGRNYAAKVMTGKGNQYKSLFKNELDIMNQLCHRNLVRLHDSYETKDSFTII  258 (1310)
Q Consensus       179 ~~~~d~Y~i~~~LG~GsFG~Vyka~~k~Tg~~vAIKiI~~~~~~~~~~~~rEI~IL~~L~HPNIVkL~d~f~~~~~lyLV  258 (1310)
                      ..+.++|++.+.||+|+||+||+|.++.||+.||||++........+.+.+|+.+|+.|+|||||+|+++|++++.+|||
T Consensus       153 ~~il~~Y~i~~~lG~G~fg~V~~~~~~~tg~~~AiK~i~~~~~~~~~~~~~Ei~il~~l~hpnIv~l~~~~~~~~~~~iv  232 (573)
T 3uto_A          153 DHVLDHYDIHEELGTGAFGVVHRVTERATGNNFAAKFVMTPHESDKETVRKEIQTMSVLRHPTLVNLHDAFEDDNEMVMI  232 (573)
T ss_dssp             SCGGGTEEEEEEEEEETTEEEEEEEETTTCCEEEEEEEECCSHHHHHHHHHHHHHHHHTCCTTBCCEEEEEECSSEEEEE
T ss_pred             CcCccccEEEEEEeeccCeEEEEEEECCCCCEEEEEEEeccchhhHHHHHHHHHHHHhCCCCCCCeEEEEEEECCEEEEE
Confidence            34568999999999999999999999999999999999876666677889999999999999999999999999999999


Q ss_pred             EecCCCCchHHHhhhc-CCCCHHHHHHHHHHHHHHHHHhhhCCeeecCCCCCCEEeecCCCCeEEEEeeccceeecCCCC
Q psy5279         259 SELAGGGELLHSLTRQ-SYYTEYDIAHYIRQLLSGLDYMHRLSIAHLGLTPGDLLVAHPGGRHLLLTDFGLSRRITSFGK  337 (1310)
Q Consensus       259 mEy~~GGeL~~~l~~~-~~lsE~~i~~ii~QIl~GL~YLHs~gIVHRDLKPeNILL~~~~~~~VKLsDFGLAr~i~~~~~  337 (1310)
                      ||||+||+|++++... +.++|.+++.|++||+.||+|||++||+||||||+|||++.+....+||+|||+|+.+.....
T Consensus       233 ~E~~~gg~L~~~i~~~~~~l~e~~~~~~~~qi~~al~ylH~~~iiHRDlKp~Nill~~~~~~~vKl~DFG~a~~~~~~~~  312 (573)
T 3uto_A          233 YEFMSGGELFEKVADEHNKMSEDEAVEYMRQVCKGLCHMHENNYVHLDLKPENIMFTTKRSNELKLIDFGLTAHLDPKQS  312 (573)
T ss_dssp             EECCCCCBHHHHHTCTTSCEEHHHHHHHHHHHHHHHHHHHHTTEECCCCCGGGEEESSSSCCCEEECCCSSCEECCTTSE
T ss_pred             EeecCCCcHHHHHHHhCCCCCHHHHHHHHHHHHHHHHHHHHCCeeeccCChhhccccCCCCCCEEEeeccceeEccCCCc
Confidence            9999999999998654 569999999999999999999999999999999999999876556899999999999988777


Q ss_pred             CCCcccchHHHhhh-------------------------cCCCccccCCCCC----CCCCCCcchhhhhhhcccchhhch
Q psy5279         338 LNPLEYDVRYVRQA-------------------------LRHPWLNFADRKP----TEDTPKLNTDALRNYYNLYKDWYG  388 (1310)
Q Consensus       338 l~~~~~t~~yv~~~-------------------------~r~P~l~~~~~~~----~~~~p~~~~~~~~~~~~~~~D~~~  388 (1310)
                      +.+.|||+.|+++.                         +..||........    ....+.+.......+...++|++.
T Consensus       313 ~~~~~GT~~y~APEv~~~~~y~~~~DiWSlGvilyeml~G~~Pf~~~~~~~~~~~i~~~~~~~~~~~~~~~s~~~~dli~  392 (573)
T 3uto_A          313 VKVTTGTAEFAAPEVAEGKPVGYYTDMWSVGVLSYILLSGLSPFGGENDDETLRNVKSCDWNMDDSAFSGISEDGKDFIR  392 (573)
T ss_dssp             EEEECSSGGGCCHHHHTTCCBCHHHHHHHHHHHHHHHHHSCCSSCCSSHHHHHHHHHTTCCCCCSGGGTTSCHHHHHHHH
T ss_pred             eeeeEECccccCHHHhCCCCCCcHHHHHHHHHHHHHHHHCCCCCCCcCHHHHHHHHHhCCCCCCcccccCCCHHHHHHHH
Confidence            77889998887642                         2233322110000    000011111222334445577777


Q ss_pred             hhhhhhcccCCCCCCccCCCccee
Q psy5279         389 NAAVRRYYRRRPLNSCYTHPSRMI  412 (1310)
Q Consensus       389 ~~~l~~~~~r~~~~~cl~hpw~~~  412 (1310)
                      ..+..+..+|+++.++|.|||+..
T Consensus       393 ~~L~~dp~~R~t~~e~l~Hpw~~~  416 (573)
T 3uto_A          393 KLLLADPNTRMTIHQALEHPWLTP  416 (573)
T ss_dssp             TTSCSSGGGSCCHHHHHHSTTTSC
T ss_pred             HHccCChhHCcCHHHHhcCcCcCC
Confidence            777888999999999999999753



>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1310
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 5e-36
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 4e-21
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 6e-15
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 8e-11
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 4e-10
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 9e-05
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 1e-35
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 5e-20
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 3e-14
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 6e-11
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 5e-10
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 3e-05
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 1e-34
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 4e-20
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 8e-13
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 5e-10
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 1e-09
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 9e-05
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 2e-33
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 1e-18
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 1e-13
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 3e-12
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 2e-08
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 8e-04
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 2e-33
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 2e-16
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 2e-10
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 3e-10
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 1e-09
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 5e-04
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 4e-33
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 9e-16
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 3e-13
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 3e-12
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 2e-08
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 2e-05
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 1e-32
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 4e-14
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 3e-11
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 4e-10
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 5e-10
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 1e-32
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 2e-16
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 4e-12
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 6e-10
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 9e-09
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 8e-04
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 3e-32
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 1e-14
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 4e-10
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 9e-10
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 7e-07
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 0.001
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 1e-30
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 4e-15
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 3e-11
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 1e-10
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 3e-08
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 9e-05
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 7e-30
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 1e-16
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 1e-14
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 2e-08
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 3e-07
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 1e-29
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 6e-15
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 7e-13
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 2e-09
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 3e-08
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 6e-04
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 2e-29
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 2e-16
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 9e-12
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 9e-11
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 1e-06
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 5e-04
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 4e-28
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 7e-12
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 4e-09
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 2e-08
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 2e-06
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 0.003
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 2e-27
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 2e-13
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 3e-10
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 1e-09
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 7e-08
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 0.004
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 2e-26
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 5e-12
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 1e-08
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 7e-07
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 2e-05
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 7e-05
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 3e-26
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 5e-15
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 7e-11
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 2e-10
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 2e-09
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 3e-26
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 9e-16
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 1e-12
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 2e-08
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 7e-07
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 0.002
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 7e-26
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 3e-12
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 9e-08
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 3e-07
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 4e-06
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 0.001
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 1e-25
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 7e-13
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 1e-08
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 2e-06
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 2e-05
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 0.002
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 1e-25
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 1e-10
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 2e-07
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 7e-07
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 1e-25
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 1e-13
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 2e-08
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 1e-06
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 1e-05
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 4e-04
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 4e-25
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 8e-14
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 3e-08
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 1e-07
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 1e-06
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 4e-25
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 1e-13
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 3e-11
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 3e-07
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 1e-06
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 9e-04
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 6e-25
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 1e-11
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 3e-08
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 3e-06
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 1e-05
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 1e-24
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 2e-11
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 2e-07
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 3e-07
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 2e-06
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 1e-24
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 2e-09
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 5e-08
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 4e-06
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 8e-04
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 0.004
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 2e-24
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 4e-11
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 4e-06
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 5e-06
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 2e-24
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 3e-13
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 4e-12
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 7e-09
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 1e-04
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 0.002
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 5e-24
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 1e-11
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 9e-08
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 2e-07
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 8e-24
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 6e-12
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 7e-08
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 1e-07
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 5e-05
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 9e-24
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 4e-12
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 3e-08
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 2e-04
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 1e-23
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 3e-11
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 1e-06
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 5e-06
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 1e-23
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 6e-13
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 1e-08
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 1e-07
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 4e-05
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 0.001
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 1e-23
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 3e-09
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 2e-07
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 2e-05
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 0.001
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 1e-23
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 8e-12
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 8e-08
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 4e-07
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 2e-05
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 2e-23
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 8e-10
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 6e-07
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 1e-06
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 0.001
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 0.003
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 2e-23
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 2e-12
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 3e-07
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 4e-07
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 2e-23
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 3e-11
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 1e-07
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 3e-07
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 4e-05
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 0.001
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 5e-23
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 4e-11
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 6e-07
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 1e-06
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 4e-06
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 6e-23
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 8e-11
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 1e-05
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 3e-05
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 5e-04
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 0.003
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 1e-22
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 4e-10
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 7e-08
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 1e-06
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 8e-05
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 0.002
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 2e-22
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 5e-10
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 1e-08
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 2e-05
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 2e-05
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 2e-22
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 4e-10
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 5e-06
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 8e-05
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 4e-22
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 6e-13
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 2e-07
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 4e-06
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 3e-05
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 5e-22
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 8e-10
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 6e-08
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 3e-04
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 0.002
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 0.003
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 7e-22
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 7e-14
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 3e-08
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 3e-05
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 3e-05
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 0.003
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 9e-22
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 1e-11
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 4e-07
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 7e-06
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 2e-04
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 1e-21
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 2e-06
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 6e-06
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 6e-04
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 0.002
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 2e-20
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 6e-09
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 4e-06
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 0.002
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 0.003
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 5e-20
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 6e-09
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 8e-06
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 0.002
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 9e-20
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 2e-06
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 3e-06
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 1e-19
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 6e-11
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 7e-07
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 1e-06
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 5e-05
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 1e-19
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 2e-09
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 5e-07
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 4e-04
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 4e-04
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 1e-19
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 1e-09
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 7e-07
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 1e-06
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 0.001
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 4e-18
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 1e-08
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 1e-06
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 6e-04
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 1e-17
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 3e-07
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 5e-06
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 5e-05
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 2e-16
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 7e-12
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 3e-07
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 3e-05
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 0.001
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 3e-16
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 3e-09
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 4e-06
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 5e-16
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 2e-05
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 2e-15
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 6e-07
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 5e-05
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 7e-04
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 7e-15
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 3e-08
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 6e-06
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 2e-04
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 3e-11
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 5e-08
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 3e-04
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 0.001
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 0.004
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 7e-07
d1ueya_127 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 6e-06
d1wisa1111 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) 6e-05
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 2e-04
d2ic2a1107 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit 3e-04
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 5e-04
d1epfa292 b.1.1.4 (A:98-189) Neural cell adhesion molecule ( 8e-04
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 0.002
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 0.002
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 0.003
d1g1ca_98 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 0.003
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 0.003
d1cs6a489 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall 0.004
d2fdbp2109 b.1.1.4 (P:2252-2360) Fibroblast growth factor rec 0.004
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 0.004
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 0.004
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Twitchin, kinase domain
species: Caenorhabditis elegans, pjk4 [TaxId: 6239]
 Score =  138 bits (348), Expect = 5e-36
 Identities = 52/177 (29%), Positives = 86/177 (48%), Gaps = 1/177 (0%)

Query: 172 RQVKTRTKPITDAYDFGDELGRGVTGIVYHAVERSSGRNYAAKVMTGKGNQYKSLFKNEL 231
           + V+ +   + D YD  +ELG G  G+V+   ER++G N+AAK +       K   + E+
Sbjct: 15  QPVEIKHDHVLDHYDIHEELGTGAFGVVHRVTERATGNNFAAKFVMTPHESDKETVRKEI 74

Query: 232 DIMNQLCHRNLVRLHDSYETKDSFTIISELAGGGELLHSLTRQ-SYYTEYDIAHYIRQLL 290
             M+ L H  LV LHD++E  +   +I E   GGEL   +  + +  +E +   Y+RQ+ 
Sbjct: 75  QTMSVLRHPTLVNLHDAFEDDNEMVMIYEFMSGGELFEKVADEHNKMSEDEAVEYMRQVC 134

Query: 291 SGLDYMHRLSIAHLGLTPGDLLVAHPGGRHLLLTDFGLSRRITSFGKLNPLEYDVRY 347
            GL +MH  +  HL L P +++        L L DFGL+  +     +        +
Sbjct: 135 KGLCHMHENNYVHLDLKPENIMFTTKRSNELKLIDFGLTAHLDPKQSVKVTTGTAEF 191


>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1310
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.98
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.98
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.98
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.98
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.98
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.98
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 99.98
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.97
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.97
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.97
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.97
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.97
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.97
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.97
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.97
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.97
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.97
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.97
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.97
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.97
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.97
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.97
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.97
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.97
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.97
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.97
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.96
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.96
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 99.96
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.96
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.96
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 99.96
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.96
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.96
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.96
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.96
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.96
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.95
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 99.95
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 99.95
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 99.95
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 99.95
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.95
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.95
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.95
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 99.94
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.93
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.88
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.31
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 98.05
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 97.67
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 97.34
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 97.25
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 96.94
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 96.65
d1wwca_105 NT3 binding domain of trkC receptor {Human (Homo s 96.52
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 96.5
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 96.32
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 96.03
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 95.97
d1wwbx_103 Ligand binding domain of trkB receptor {Human (Hom 95.96
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 95.65
d2dava1113 Myosin-binding protein C, slow-type {Human (Homo s 95.62
d1he7a_107 High affinity nerve growth factor receptor TrkA, d 95.4
d2crma1107 Fibronectin type-III domain containing protein 3a, 95.02
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 94.91
d1nw1a_395 Choline kinase {Caenorhabditis elegans [TaxId: 623 94.64
d1iray1101 Type-1 interleukin-1 receptor {Human (Homo sapiens 94.52
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 94.48
d2oz4a384 Intercellular adhesion molecule-1, ICAM-1 {Human ( 94.47
d2crza197 Fibronectin type-III domain containing protein 3a, 94.38
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 94.37
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 94.37
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 94.22
d2crya1115 Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s 93.79
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 93.63
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 93.33
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 93.2
d1x5xa196 Fibronectin type-III domain containing protein 3a, 93.2
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 93.16
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 93.05
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 92.96
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 92.95
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 92.91
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 92.63
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 92.14
d1x3da1105 Fibronectin type-III domain containing protein 3a, 91.92
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 91.86
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 91.85
d2aw2a1104 B- and T-lymphocyte attenuator CD272 {Human (Homo 91.83
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 91.36
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 91.29
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 91.27
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 91.14
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 90.96
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 90.85
d1pkoa_126 Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra 90.39
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 89.87
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 89.86
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 89.82
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 89.81
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 89.68
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 89.6
d1f2qa289 IgE high affinity receptor alpha subunit {Human (H 89.35
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 89.28
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 89.05
d1nbqa2104 Junction adhesion molecule, JAM, C-terminal domain 88.88
d1iray2103 Type-1 interleukin-1 receptor {Human (Homo sapiens 88.59
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 88.19
d1rhfa285 Tyrosine-protein kinase receptor tyro3, second dom 88.01
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 87.99
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 87.91
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 87.71
d1x4xa193 Fibronectin type-III domain containing protein 3a, 87.49
d1f97a1102 Junction adhesion molecule, JAM, N-terminal domain 87.14
d1epfa292 Neural cell adhesion molecule (NCAM) {Rat (Rattus 86.76
d2fcba288 Fc gamma receptor ectodomain (CD32) {Human (Homo s 86.46
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 86.43
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 86.2
d1olza192 Semaphorin 4d Ig-like domain {Human (Homo sapiens) 85.95
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 85.95
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 85.92
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 85.35
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 85.02
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 84.76
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 84.51
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 84.44
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 84.11
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 84.11
d1fnla289 Fc gamma receptor ectodomain (CD32) {Human (Homo s 83.33
d2ifga192 High affinity nerve growth factor receptor TrkA, d 82.85
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 82.45
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 82.4
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 81.68
d1iama1103 Intercellular cell adhesion molecule-1 (ICAM-1) {H 80.89
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 80.82
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 80.65
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 80.57
d1hnga198 CD2, first domain {Rat (Rattus norvegicus) [TaxId: 80.33
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Cell cycle checkpoint kinase chk1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.9e-44  Score=396.47  Aligned_cols=204  Identities=22%  Similarity=0.408  Sum_probs=166.5

Q ss_pred             CCCCcchhhhhhccccchhhhHHHHhhccccceeeeecccCc--chhhhhhHHhhhhhhhchhhHHHHHHhcCCCCcccc
Q psy5279         593 PPTDKYQFISEIHRGKFSVVVKAAEKANTENLVAAKLFEYSH--DTLHQVNTEFDNLRSLRHERIASLLEAYKPSTTASN  670 (1310)
Q Consensus       593 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  670 (1310)
                      |-.+.|+++..|-+|.||.|.+|..+. |++.||.|++....  +....+..|...|++|+|+||..+++++...    +
T Consensus         2 Pf~~dy~~~~~lG~G~fg~V~~~~~~~-~~~~vAiK~i~~~~~~~~~~~~~~Ei~~l~~l~HpnIv~~~~~~~~~----~   76 (271)
T d1nvra_           2 PFVEDWDLVQTLGEGAYGEVQLAVNRV-TEEAVAVKIVDMKRAVDCPENIKKEICINKMLNHENVVKFYGHRREG----N   76 (271)
T ss_dssp             TTTTEEEEEEEEEEETTEEEEEEEETT-TCCEEEEEEEECC-------CHHHHHHHHHTCCCTTBCCEEEEEEET----T
T ss_pred             CCCcceEEEEEEecCcCeEEEEEEECC-CCCEEEEEEEehhhcchHHHHHHHHHHHHHhCCCCCEeeEeeeeccC----c
Confidence            446789999999999999999988776 88999999987654  3456788999999999999999999999876    6


Q ss_pred             hhhHHHHhhcCchhhhhhhccccchhhhHHHHHHHhHHHHhhhhhhhhhcccccCCCchhhHHHhhhhcccccccccccc
Q psy5279         671 IAVLVMEKLQGADVLSYLSSRHEYTEQNVATIISQAWEHYLKKNREQIADTADKSRIPRTIREYREQSANTANLRDVKTW  750 (1310)
Q Consensus       671 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  750 (1310)
                      ...||||||.|.++.++|..+..++|+++.                                                  
T Consensus        77 ~~~ivmEy~~gg~L~~~l~~~~~l~e~~~~--------------------------------------------------  106 (271)
T d1nvra_          77 IQYLFLEYCSGGELFDRIEPDIGMPEPDAQ--------------------------------------------------  106 (271)
T ss_dssp             EEEEEEECCTTEEGGGGSBTTTBCCHHHHH--------------------------------------------------
T ss_pred             eeEEEEeccCCCcHHHHHhcCCCCCHHHHH--------------------------------------------------
Confidence            678999999999998888665555554433                                                  


Q ss_pred             cCCCCCCCCcccccccccccccccccCCcchhhccccCCcchhhHHHHHHhcCCCCcccccccccccCCCCCCCCCCcch
Q psy5279         751 EDNVPNRGPAIDYDLNVVKSESHYQNGPDTYLLQLRDVDFPVRLREYIKVASTRPDLRLSTGFNCLDTSENGHLDWKAPV  830 (1310)
Q Consensus       751 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  830 (1310)
                                                                                                      
T Consensus       107 --------------------------------------------------------------------------------  106 (271)
T d1nvra_         107 --------------------------------------------------------------------------------  106 (271)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhcccccccchhhhHHHHHhhhhccccccchhhhhhhcccCCCchhhHhHHHHHhhhcCCCCCceeecceeeeeeeCCE
Q psy5279         831 IRERRRFTDVMDEEIDDERRNRINKYGAADTYTLRRLRHEIGTRPEAHVEADALIESRRDGHAPFFREKPITIPVVIGDK  910 (1310)
Q Consensus       831 ~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~l~~e~~~~~~~~~~a~~~ie~~~~~~~~ffrE~~~~~~l~~g~~  910 (1310)
                                                                                                      
T Consensus       107 --------------------------------------------------------------------------------  106 (271)
T d1nvra_         107 --------------------------------------------------------------------------------  106 (271)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             EEEEEeccCCCcceeeecccCCcccccccccCCCchhHHHHHHHHHHHHHHHHHCCceecccCCCcEEEeecCCCcEEEE
Q psy5279         911 LEMKCLAVGEPKPVIQWFKLGTSTLCYLPIVIPTTHKDAYCVTSVLDGLQYLHWRGLCHLNIEPDNVVMASVRSVQVKLI  990 (1310)
Q Consensus       911 l~~~~l~~G~p~~vi~~f~~g~~l~~~L~~~i~~~~~~~~i~~QIl~AL~yLHs~gIVHRDLKPeNILl~~~~~~~VKL~  990 (1310)
                                                             .++.||++||+|||++|||||||||+|||++.  ++.+||+
T Consensus       107 ---------------------------------------~i~~qi~~al~ylH~~~IiHrDiKp~NILl~~--~~~~KL~  145 (271)
T d1nvra_         107 ---------------------------------------RFFHQLMAGVVYLHGIGITHRDIKPENLLLDE--RDNLKIS  145 (271)
T ss_dssp             ---------------------------------------HHHHHHHHHHHHHHHTTEECSCCCGGGEEECT--TCCEEEC
T ss_pred             ---------------------------------------HHHHHHHHHHHHHHHcCCccCcccHHHEEECC--CCCEEEc
Confidence                                                   34569999999999999999999999999985  4569999


Q ss_pred             eeccceeeccCCc-ccccCCCCCCcccccccccCCCCC-CccchhHHHHHHHHHhcCCCCCCCC
Q psy5279         991 DLGCTQRVTKLGT-LIHPINTPNPEFAAPEVLAEEPIF-PQTDVWSAGVLAYVLLSGASPFRGQ 1052 (1310)
Q Consensus       991 DFGlAk~~~~~g~-~~~~~~tGtp~Y~APEvl~~~~ys-~ksDIWSLGViLyeLLtG~~PF~g~ 1052 (1310)
                      |||+|+....... .......|||.|||||++.+..+. .++|||||||++|+|++|.+||.+.
T Consensus       146 DFG~a~~~~~~~~~~~~~~~~GT~~Y~APE~~~~~~~~~~~~DiwSlGvilyeml~G~~pf~~~  209 (271)
T d1nvra_         146 DFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPWDQP  209 (271)
T ss_dssp             CCTTCEECEETTEECCBCCCCSCGGGSCTHHHHCSSBCHHHHHHHHHHHHHHHHHHSSCSCSSS
T ss_pred             cchhheeeccCCccccccceeeCcCccCHhHhcCCCCCCCceeeeHhHHHHHHHHhCCCCCCCC
Confidence            9999987643322 222345688999999999888764 6789999999999999999998654



>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure