Diaphorina citri psyllid: psy5301


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MVIFHIEKGPFIEDFYQCVTYGFYTEPWQEQLYSCFSLFFMFICPLLILVTTYVSTFLTISRKCFMSFMVIFHIEKGPFIEDFYQCVTYGFYTEPWQEQLYSCFSLFFMFICPLLILVTTYVSTFLTISRTY
cEEEEEEccccccccEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEcccccccEEEEEEEcccccccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
MVIFHIEKGPFIEDFYQCVTYGFYTEPWQEQLYSCFSLFFMFICPLLILVTTYVSTFLTISRKCFMSFMVIFHIEKGPFIEDFYQCVTYGFYTEPWQEQLYSCFSLFFMFICPLLILVTTYVSTFLTISRT*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVIFHIEKGPFIEDFYQCVTYGFYTEPWQEQLYSCFSLFFMFICPLLILVTTYVSTFLTISRKCFMSFMVIFHIEKGPFIEDFYQCVTYGFYTEPWQEQLYSCFSLFFMFICPLLILVTTYVSTFLTISRTY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0097211 [BP]cellular response to gonadotropin-releasing hormoneprobableGO:0070887, GO:0044699, GO:0009719, GO:0051716, GO:0071375, GO:0071417, GO:0071310, GO:0071495, GO:0009987, GO:0032870, GO:0044763, GO:0010243, GO:0042221, GO:0043434, GO:0010033, GO:1901700, GO:1901701, GO:0097210, GO:0009725, GO:0050896, GO:1901699, GO:1901652, GO:1901653, GO:0008150, GO:1901698

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AMJ, chain A
Confidence level:probable
Coverage over the Query: 54-131
View the alignment between query and template
View the model in PyMOL
Template: 3VW7, chain A
Confidence level:probable
Coverage over the Query: 13-64
View the alignment between query and template
View the model in PyMOL