Psyllid ID: psy5301


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MVIFHIEKGPFIEDFYQCVTYGFYTEPWQEQLYSCFSLFFMFICPLLILVTTYVSTFLTISRKCFMSFMVIFHIEKGPFIEDFYQCVTYGFYTEPWQEQLYSCFSLFFMFICPLLILVTTYVSTFLTISRTY
cEEEEEEccccccccEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEcccccccEEEEEEEcccccccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
cEEEEEEccccccccEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
mvifhiekgpfiedFYQCVTygfytepwqeQLYSCFSLFFMFICPLLILVTTYVSTFLTISRKCFMSFMVIFHIekgpfiedFYQCVTygfytepwqeQLYSCFSLFFMFICPLLILVTTYVSTFLTISRTY
MVIFhiekgpfieDFYQCVTYGFYTEPWQEQLYSCFSLFFMFICPLLILVTTYVSTFLTISRKCFMSFMVIFHIEKGPFIEDFYQCVTYGFYTEPWQEQLYSCFSLFFMFICPLLILVTTYVSTFLTISRTY
MVIFHIEKGPFIEDFYQCVTYGFYTEPWQEQLYSCFSLFFMFICPLLILVTTYVSTFLTISRKCFMSFMVIFHIEKGPFIEDFYQCVTYGFYTEPWQEQLYSCFSLFFMFICPLLILVTTYVSTFLTISRTY
*VIFHIEKGPFIEDFYQCVTYGFYTEPWQEQLYSCFSLFFMFICPLLILVTTYVSTFLTISRKCFMSFMVIFHIEKGPFIEDFYQCVTYGFYTEPWQEQLYSCFSLFFMFICPLLILVTTYVSTFLTI****
MVIFHIEKGPFIEDFYQCVTYGFYTEPWQEQLYSCFSLFFMFICPLLILVTTYVSTFLTISRKCFMSFMVIFHIEKGPFIEDFYQCVTYGFYTEPWQEQLYSCFSLFFMFICPLLILVTTYVSTFLTISRT*
MVIFHIEKGPFIEDFYQCVTYGFYTEPWQEQLYSCFSLFFMFICPLLILVTTYVSTFLTISRKCFMSFMVIFHIEKGPFIEDFYQCVTYGFYTEPWQEQLYSCFSLFFMFICPLLILVTTYVSTFLTISRTY
MVIFHIEKGPFIEDFYQCVTYGFYTEPWQEQLYSCFSLFFMFICPLLILVTTYVSTFLTISRKCFMSFMVIFHIEKGPFIEDFYQCVTYGFYTEPWQEQLYSCFSLFFMFICPLLILVTTYVSTFLTISRT*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiii
ooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiii
oooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooo
ooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooo
oooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVIFHIEKGPFIEDFYQCVTYGFYTEPWQEQLYSCFSLFFMFICPLLILVTTYVSTFLTISRKCFMSFMVIFHIEKGPFIEDFYQCVTYGFYTEPWQEQLYSCFSLFFMFICPLLILVTTYVSTFLTISRTY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query132 2.2.26 [Sep-21-2011]
Q2V2K5 407 Gonadotropin-releasing ho N/A N/A 0.454 0.147 0.412 6e-05
O42329 379 Gonadotropin-releasing ho N/A N/A 0.583 0.203 0.301 0.0004
>sp|Q2V2K5|GNRHR_OCTVU Gonadotropin-releasing hormone receptor OS=Octopus vulgaris GN=GNRHR PE=2 SV=1 Back     alignment and function desciption
 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 3/63 (4%)

Query: 70  VIFHIEKGPFIED-FYQCVTYGFYTEPWQEQLYSCFSLFFMFICPLLILVTTYVSTFLTI 128
           VIF  ++  F +  F+QC     Y   WQ+QLYS  SL  +F+ PL+I+VT+Y+    TI
Sbjct: 166 VIFQEQRKMFRQGMFHQC--RDSYNALWQKQLYSASSLILLFVIPLIIMVTSYLLILKTI 223

Query: 129 SRT 131
            +T
Sbjct: 224 VKT 226




Receptor for gonadotropin releasing hormone (GnRH) that mediates the action of GnRH to stimulate the secretion of the gonadotropic hormones luteinizing hormone (LH) and follicle-stimulating hormone (FSH). This receptor mediates its action by association with G-proteins that activate a phosphatidylinositol-calcium second messenger system. Ligand interaction triggers steroidogenesis in spermatozoa and follicles. Appears to be involved in contraction of the radula retractor muscle.
Octopus vulgaris (taxid: 6645)
>sp|O42329|GNRR2_CLAGA Gonadotropin-releasing hormone II receptor OS=Clarias gariepinus PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query132
322797460158 hypothetical protein SINV_06836 [Solenop 0.484 0.405 0.734 1e-20
307181813223 Gonadotropin-releasing hormone II recept 0.621 0.367 0.588 1e-20
350401174 410 PREDICTED: gonadotropin-releasing hormon 0.568 0.182 0.625 2e-20
340720669 410 PREDICTED: gonadotropin-releasing hormon 0.477 0.153 0.730 5e-20
322782694219 hypothetical protein SINV_11533 [Solenop 0.484 0.292 0.671 9e-20
157129464 298 corazonin receptor [Aedes aegypti] 0.598 0.265 0.583 2e-19
383860410 414 PREDICTED: gonadotropin-releasing hormon 0.477 0.152 0.698 2e-19
38349490 611 G-protein coupled receptor [Anopheles ga 0.727 0.157 0.469 3e-19
31242249 612 AGAP001558-PA [Anopheles gambiae str. PE 0.727 0.156 0.469 3e-19
170062992 297 corazonin receptor [Culex quinquefasciat 0.598 0.265 0.583 4e-19
>gi|322797460|gb|EFZ19531.1| hypothetical protein SINV_06836 [Solenopsis invicta] Back     alignment and taxonomy information
 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 54/64 (84%)

Query: 68  FMVIFHIEKGPFIEDFYQCVTYGFYTEPWQEQLYSCFSLFFMFICPLLILVTTYVSTFLT 127
           F+ +FH+ +GPFIE+F QCVT+G YTEPWQEQLY  FSLFFMFI PL IL+TTYVST LT
Sbjct: 15  FIAVFHVAQGPFIEEFTQCVTHGVYTEPWQEQLYGGFSLFFMFILPLAILITTYVSTVLT 74

Query: 128 ISRT 131
           ISR 
Sbjct: 75  ISRN 78




Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307181813|gb|EFN69256.1| Gonadotropin-releasing hormone II receptor [Camponotus floridanus] Back     alignment and taxonomy information
>gi|350401174|ref|XP_003486073.1| PREDICTED: gonadotropin-releasing hormone receptor-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340720669|ref|XP_003398755.1| PREDICTED: gonadotropin-releasing hormone receptor-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|322782694|gb|EFZ10548.1| hypothetical protein SINV_11533 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|157129464|ref|XP_001655399.1| corazonin receptor [Aedes aegypti] Back     alignment and taxonomy information
>gi|383860410|ref|XP_003705682.1| PREDICTED: gonadotropin-releasing hormone receptor-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|38349490|gb|AAQ67361.1| G-protein coupled receptor [Anopheles gambiae] Back     alignment and taxonomy information
>gi|31242249|ref|XP_321555.1| AGAP001558-PA [Anopheles gambiae str. PEST] gi|19572378|emb|CAD27924.1| putative G-protein coupled receptor [Anopheles gambiae] gi|30173795|gb|EAA01361.2| AGAP001558-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|170062992|ref|XP_001866911.1| corazonin receptor [Culex quinquefasciatus] gi|167880759|gb|EDS44142.1| corazonin receptor [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query132
FB|FBgn0036278 579 GRHRII "GRHRII" [Drosophila me 0.803 0.183 0.464 8.7e-18
UNIPROTKB|F1P1J8345 GNRHR "Uncharacterized protein 0.477 0.182 0.380 4.2e-09
ZFIN|ZDB-GENE-090128-2 377 gnrhr1 "gonadotropin releasing 0.583 0.204 0.277 8.2e-05
ZFIN|ZDB-GENE-090128-3 412 gnrhr2 "gonadotropin releasing 0.462 0.148 0.360 4.1e-08
UNIPROTKB|F1NN71 371 CGNRH-R "Uncharacterized prote 0.590 0.210 0.309 5.1e-06
ZFIN|ZDB-GENE-090128-1336 gnrhr3 "gonadotropin releasing 0.469 0.184 0.349 5.7e-07
ZFIN|ZDB-GENE-050419-76406 gnrhr4 "gonadotropin releasing 0.477 0.155 0.333 7.6e-06
FB|FBgn0025595 455 GRHR "Gonadotropin-releasing h 0.462 0.134 0.311 9.1e-06
UNIPROTKB|P49922328 GNRHR "Gonadotropin-releasing 0.477 0.192 0.317 0.00011
UNIPROTKB|F1SDF2286 GNRHR2 "Uncharacterized protei 0.446 0.206 0.333 0.00011
FB|FBgn0036278 GRHRII "GRHRII" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 225 (84.3 bits), Expect = 8.7e-18, P = 8.7e-18
 Identities = 53/114 (46%), Positives = 67/114 (58%)

Query:    16 YQCVTYGFYTEPWQEQLYSCFSLFFMFICPLLILVTTYVSTFLTISRKCFMSFMVIFHIE 75
             Y  V  G   + W    Y   SL     C  L L  TY+ + L +S   F     IFH+ 
Sbjct:   214 YVLVLIG--VDRWIAVKYPMKSLNMAKRCHRL-LGGTYILS-LVLSLPQFF----IFHVA 265

Query:    76 KGPFIEDFYQCVTYGFYTEPWQEQLYSCFSLFFMFICPLLILVTTYVSTFLTIS 129
             +GPF+E+FYQCVT+GFYT  WQEQ+Y+ F+L F F+ PL IL  TY+STF TIS
Sbjct:   266 RGPFVEEFYQCVTHGFYTADWQEQMYATFTLVFTFLLPLCILFGTYMSTFRTIS 319


GO:0016500 "protein-hormone receptor activity" evidence=ISS
GO:0016021 "integral to membrane" evidence=ISS;NAS
GO:0007186 "G-protein coupled receptor signaling pathway" evidence=ISS;NAS
GO:0004968 "gonadotropin-releasing hormone receptor activity" evidence=ISS
GO:0008188 "neuropeptide receptor activity" evidence=ISS
GO:0004930 "G-protein coupled receptor activity" evidence=ISS;NAS
GO:0097003 "adipokinetic hormone receptor activity" evidence=ISS
GO:0097004 "adipokinetic hormone binding" evidence=ISS
GO:0005887 "integral to plasma membrane" evidence=ISS
GO:0001653 "peptide receptor activity" evidence=IDA
GO:0035237 "corazonin receptor activity" evidence=IDA;NAS
UNIPROTKB|F1P1J8 GNRHR "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090128-2 gnrhr1 "gonadotropin releasing hormone receptor 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090128-3 gnrhr2 "gonadotropin releasing hormone receptor 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NN71 CGNRH-R "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090128-1 gnrhr3 "gonadotropin releasing hormone receptor 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050419-76 gnrhr4 "gonadotropin releasing hormone receptor 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0025595 GRHR "Gonadotropin-releasing hormone receptor" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P49922 GNRHR "Gonadotropin-releasing hormone receptor" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1SDF2 GNRHR2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 132
KOG4219|consensus 423 98.35
PHA03234 338 DNA packaging protein UL33; Provisional 98.09
PHA02834 323 chemokine receptor-like protein; Provisional 97.82
PHA03235 409 DNA packaging protein UL33; Provisional 97.8
PHA02638 417 CC chemokine receptor-like protein; Provisional 97.76
PF00001257 7tm_1: 7 transmembrane receptor (rhodopsin family) 97.31
PHA03087 335 G protein-coupled chemokine receptor-like protein; 97.0
PHA03235 409 DNA packaging protein UL33; Provisional 95.81
PHA03234338 DNA packaging protein UL33; Provisional 95.7
KOG4219|consensus 423 94.92
PHA02638417 CC chemokine receptor-like protein; Provisional 93.77
PHA02834323 chemokine receptor-like protein; Provisional 92.91
PF00001257 7tm_1: 7 transmembrane receptor (rhodopsin family) 91.0
KOG4220|consensus 503 90.82
PHA03087335 G protein-coupled chemokine receptor-like protein; 81.93
>KOG4219|consensus Back     alignment and domain information
Probab=98.35  E-value=9.7e-07  Score=69.51  Aligned_cols=78  Identities=18%  Similarity=0.191  Sum_probs=57.1

Q ss_pred             HHHhhhhhccceeeeEEEEEeeecC--CccCceeeee-ccCC--CChhHH---HHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy5301          54 VSTFLTISRKCFMSFMVIFHIEKGP--FIEDFYQCVT-YGFY--TEPWQE---QLYSCFSLFFMFICPLLILVTTYVSTF  125 (132)
Q Consensus        54 ~~iiw~ls~~~s~P~l~~~~~~~~~--~~~~~~~C~~-~~~~--~~~~~~---~~~~~~~~~~~F~iPl~ii~~cY~~I~  125 (132)
                      ++++|.++...+.|+..+++..+.+  ++.....|.. +.+.  +.+...   +.|+...+++.|++|++||.++|++|+
T Consensus       154 IllIW~lA~l~a~P~~l~s~v~~~~~~d~~~~~~~~~~~pe~~~~~~~~~~~~~~y~~vl~~lqYflPliVl~~~Yt~ia  233 (423)
T KOG4219|consen  154 ILLIWALALLLALPQLLYSSVEELYLYDGESRVVCVTAWPEHVCPTENESLLMQGYNYVLLFLQYFLPLIVLGLAYTVIA  233 (423)
T ss_pred             hHHHHHHHHHHhccceeeeeeEEeeccCCcceEEEEEecccccCCcchhhhhhcceeeeehhHHHHHHHHHHHHHHHHHH
Confidence            5679999999999999998877643  2333567742 2221  222211   237777788899999999999999999


Q ss_pred             HHHhhc
Q psy5301         126 LTISRT  131 (132)
Q Consensus       126 ~~L~~~  131 (132)
                      ++||.+
T Consensus       234 v~LW~~  239 (423)
T KOG4219|consen  234 VTLWGR  239 (423)
T ss_pred             HHHHhc
Confidence            999974



>PHA03234 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PHA02834 chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA03235 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PHA02638 CC chemokine receptor-like protein; Provisional Back     alignment and domain information
>PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PHA03087 G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA03235 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PHA03234 DNA packaging protein UL33; Provisional Back     alignment and domain information
>KOG4219|consensus Back     alignment and domain information
>PHA02638 CC chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA02834 chemokine receptor-like protein; Provisional Back     alignment and domain information
>PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG4220|consensus Back     alignment and domain information
>PHA03087 G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query132
4grv_A 510 Neurotensin receptor type 1, lysozyme chimera; G-p 98.28
3odu_A 502 C-X-C chemokine receptor type 4, lysozyme chimera; 98.1
3vw7_A 484 Proteinase-activated receptor 1, lysozyme; high re 97.99
4dkl_A 464 MU-type opioid receptor, lysozyme chimera; G-prote 97.7
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 97.67
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 97.54
2ks9_A 364 Substance-P receptor; water, autodock, NK1, neurop 97.43
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 97.37
4ea3_A 434 Fusion protein of nociceptin receptor and cytochr; 97.36
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 97.25
1u19_A 349 Rhodopsin; G protein-coupled receptor, membrane pr 97.06
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 97.06
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 96.82
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 96.81
2lnl_A296 C-X-C chemokine receptor type 1; G protein coupled 96.64
3sn6_R 514 Lysozyme, beta-2 adrenergic receptor; seven transm 96.45
3odu_A 502 C-X-C chemokine receptor type 4, lysozyme chimera; 96.44
4amj_A 315 Beta-1 adrenergic receptor; membrane protein, 7TMR 96.23
4grv_A 510 Neurotensin receptor type 1, lysozyme chimera; G-p 96.05
3vw7_A 484 Proteinase-activated receptor 1, lysozyme; high re 95.9
4eiy_A 447 Adenosine receptor A2A/soluble cytochrome B562 CH; 95.66
2ks9_A364 Substance-P receptor; water, autodock, NK1, neurop 94.87
4dkl_A 464 MU-type opioid receptor, lysozyme chimera; G-prote 94.79
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 94.04
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 93.9
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 93.62
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 93.07
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 91.97
1u19_A349 Rhodopsin; G protein-coupled receptor, membrane pr 91.59
4ea3_A434 Fusion protein of nociceptin receptor and cytochr; 91.07
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 91.07
4amj_A315 Beta-1 adrenergic receptor; membrane protein, 7TMR 89.54
3sn6_R514 Lysozyme, beta-2 adrenergic receptor; seven transm 88.9
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 87.44
2lnl_A296 C-X-C chemokine receptor type 1; G protein coupled 82.43
4eiy_A 447 Adenosine receptor A2A/soluble cytochrome B562 CH; 80.24
>4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} Back     alignment and structure
Probab=98.28  E-value=3.9e-06  Score=66.56  Aligned_cols=75  Identities=9%  Similarity=0.124  Sum_probs=54.8

Q ss_pred             HHHhhhhhccceeeeEEEEEeeecCC---ccCceeeeeccCCCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Q psy5301          54 VSTFLTISRKCFMSFMVIFHIEKGPF---IEDFYQCVTYGFYTEPWQEQLYSCFSLFFMFICPLLILVTTYVSTFLTISR  130 (132)
Q Consensus        54 ~~iiw~ls~~~s~P~l~~~~~~~~~~---~~~~~~C~~~~~~~~~~~~~~~~~~~~~~~F~iPl~ii~~cY~~I~~~L~~  130 (132)
                      +.++|.++...++|.++..+..+...   ..+...|  .+.++... ...|....++++|++|+++|++||.+|.++|++
T Consensus       158 i~~~W~~s~~~~~p~~~~~~~~~~~~~~~~~~~~~c--~~~~~~~~-~~~~~~~~~~~~f~iP~~ii~~~Y~~I~~~l~~  234 (510)
T 4grv_A          158 ISAIWLASALLAIPMLFTMGLQNRSADGTHPGGLVC--TPIVDTAT-VKVVIQVNTFMSFLFPMLVISILNTVIANKLTV  234 (510)
T ss_dssp             HHHHHHHHHHHHTTHHHHEEEEECSSSSCCGGGEEE--EECSCHHH-HHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHT
T ss_pred             ehHHHHHHHHHHHHHHHhhcccccccCCCCCCcccc--ccccccch-hhhhhhhhhhHHHhhhHHHHHHHHHHHHHHHHH
Confidence            56789999999999887666544321   1224567  34444433 456677778889999999999999999999986


Q ss_pred             c
Q psy5301         131 T  131 (132)
Q Consensus       131 ~  131 (132)
                      +
T Consensus       235 ~  235 (510)
T 4grv_A          235 M  235 (510)
T ss_dssp             S
T ss_pred             H
Confidence            4



>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Back     alignment and structure
>3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} Back     alignment and structure
>2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Back     alignment and structure
>4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} Back     alignment and structure
>3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} Back     alignment and structure
>2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query132
d1u19a_ 348 Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} 93.36
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]
Probab=93.36  E-value=0.006  Score=43.13  Aligned_cols=35  Identities=17%  Similarity=0.464  Sum_probs=28.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhc
Q psy5301          97 QEQLYSCFSLFFMFICPLLILVTTYVSTFLTISRT  131 (132)
Q Consensus        97 ~~~~~~~~~~~~~F~iPl~ii~~cY~~I~~~L~~~  131 (132)
                      ....+.+..+...+++|+.++.++|.+|.++++++
T Consensus       199 ~~~~~~~~~~~~~~~ip~~i~~~~y~~i~~~~~~~  233 (348)
T d1u19a_         199 NNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEA  233 (348)
T ss_dssp             THHHHHHHHHHHTTHHHHHHHHHHHTTTTTSSCSC
T ss_pred             cchhhHHHHHHHHHHHHHHHHHHHHHHHHhhhccc
Confidence            34566666777888999999999999998887653