Diaphorina citri psyllid: psy5326


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------
MHLVYFKIPDNKLSTQDLHARYEGLIKEDEDKIIPGLGENGRAGTLPGLTNDIITKIMKIEAFNKVLSDHISYTRKIPDARFPECHELKYDEDLPTIGGFSWSGHYTWIPIPDFDTRIMNNPTDPVPPDFKNLEHPPIKCITFTPTPLEKILDTALC
cCEEEEEccccccccccHHHHHHHcccHHHHccccccccccCEEccccccHHHHHHHHHHHccHHHHHHcccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccc
MHLVYFKIPDNKLSTQDLHARYEGLIKEDEDKIIPGLGENGRAGTLPGLTNDIITKIMKIEAFNKVLSDHISYTRKIPDARFPECHELKYDEDLPTIGGFSWSGHYTWIPIPDFDTRIMNNPTDPVPPDFKNLEHPPIKCITFTPTPLEKILDTALC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHLVYFKIPDNKLSTQDLHARYEGLIKEDEDKIIPGLGENGRAGTLPGLTNDIITKIMKIEAFNKVLSDHISYTRKIPDARFPECHELKYDEDLPTIGGFSWSGHYTWIPIPDFDTRIMNNPTDPVPPDFKNLEHPPIKCITFTPTPLEKILDTALC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:1901576 [BP]organic substance biosynthetic processprobableGO:0071704, GO:0009058, GO:0008150, GO:0008152
GO:0044723 [BP]single-organism carbohydrate metabolic processprobableGO:0008150, GO:0044238, GO:0005975, GO:0008152, GO:0071704

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2D7I, chain A
Confidence level:very confident
Coverage over the Query: 30-136
View the alignment between query and template
View the model in PyMOL