Diaphorina citri psyllid: psy5338


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70------
MSQLVTPADVKKSYRKACLAVHPDKILEWTEGKKGNIRALLCSLHTILWEGAKWKCEMSQLVTPADVKKSYRKACT
ccccccHHHHHHHHHHHHHcccHHHHHHHHccccccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHcc
************SYRKACLAVHPDKILEWTEGKKGNIRALLCSLHTILWEGAKWKCEMSQLVTPADVKKSYRKACT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQLVTPADVKKSYRKACLAVHPDKILEWTEGKKGNIRALLCSLHTILWEGAKWKCEMSQLVTPADVKKSYRKACT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative tyrosine-protein phosphatase auxilin Recruits HSPA8/HSC70 to clathrin-coated vesicles and promotes uncoating of clathrin-coated vesicles.confidentO75061
Putative tyrosine-protein phosphatase auxilin Recruits HSPA8/HSC70 to clathrin-coated vesicles and promotes uncoating of clathrin-coated vesicles.confidentQ80TZ3
UBA domain-containing protein 7 confidentO13773

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005795 [CC]Golgi stackprobableGO:0005737, GO:0005794, GO:0043231, GO:0043229, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0016192 [BP]vesicle-mediated transportprobableGO:0006810, GO:0008150, GO:0051179, GO:0051234
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0050789 [BP]regulation of biological processprobableGO:0008150, GO:0065007
GO:0030332 [MF]cyclin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QWO, chain B
Confidence level:very confident
Coverage over the Query: 25-76
View the alignment between query and template
View the model in PyMOL
Template: 1N4C, chain A
Confidence level:very confident
Coverage over the Query: 1-44
View the alignment between query and template
View the model in PyMOL