Psyllid ID: psy5338


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70------
MSQLVTPADVKKSYRKACLAVHPDKILEWTEGKKGNIRALLCSLHTILWEGAKWKCEMSQLVTPADVKKSYRKACT
ccccccHHHHHHHHHHHHHcccHHHHHHHHccccccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHcc
ccccccHHHHHHHHHHHHHcccHHHHHHHHHccHHHHHHHHHHHHHHccccccccccHHHcccHHHHHHHHHHHcc
msqlvtpadvKKSYRKAClavhpdkilewtegkkgNIRALLCSLHTILWEGAKWKcemsqlvtpadvKKSYRKACT
msqlvtpadvkksyrkaclavhpdkilewtegkkgnIRALLCSLHTILWEGAKWKCEmsqlvtpadvkKSYRKACT
MSQLVTPADVKKSYRKACLAVHPDKILEWTEGKKGNIRALLCSLHTILWEGAKWKCEMSQLVTPADVKKSYRKACT
************SYRKACLAVHPDKILEWTEGKKGNIRALLCSLHTILWEGAKWKCEMSQLVT*************
*********************HPDKILEWTEGKKGNIRALLCSLHTILWEGAKWKCEMSQLVTPADVKKSYRKACT
**********KKSYRKACLAVHPDKILEWTEGKKGNIRALLCSLHTILWEGAKWKCEMSQLVTP************
*****TPADVKKSYRKACLAVHPDKILEWTEGKKGNIRALLCSLHTILWEGAKWKCEMSQLVTPADVKKSYRKACT
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQLVTPADVKKSYRKACLAVHPDKILEWTEGKKGNIRALLCSLHTILWEGAKWKCEMSQLVTPADVKKSYRKACT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query76 2.2.26 [Sep-21-2011]
O75061913 Putative tyrosine-protein yes N/A 0.657 0.054 0.653 1e-11
Q27974910 Putative tyrosine-protein no N/A 0.657 0.054 0.653 1e-11
Q80TZ3938 Putative tyrosine-protein yes N/A 0.657 0.053 0.634 3e-11
P978741305 Cyclin-G-associated kinas no N/A 0.789 0.045 0.530 9e-11
Q99KY41305 Cyclin-G-associated kinas no N/A 0.789 0.045 0.530 1e-10
O149761311 Cyclin-G-associated kinas no N/A 0.789 0.045 0.515 8e-10
O13773697 UBA domain-containing pro yes N/A 0.644 0.070 0.52 4e-07
Q9SU08904 Auxilin-related protein 1 no N/A 0.657 0.055 0.470 1e-06
Q0WQ57891 Auxilin-related protein 2 no N/A 0.657 0.056 0.470 1e-06
>sp|O75061|AUXI_HUMAN Putative tyrosine-protein phosphatase auxilin OS=Homo sapiens GN=DNAJC6 PE=1 SV=3 Back     alignment and function desciption
 Score = 68.6 bits (166), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 34/52 (65%), Positives = 39/52 (75%), Gaps = 2/52 (3%)

Query: 25  KILEWTEGKKGNIRALLCSLHTILWEG-AKWK-CEMSQLVTPADVKKSYRKA 74
           KILEW EGK+ NIRALL ++HT+LW G  KWK   M+ LVTP  VKK YRKA
Sbjct: 821 KILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKA 872




Recruits HSPA8/HSC70 to clathrin-coated vesicles and promotes uncoating of clathrin-coated vesicles.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|Q27974|AUXI_BOVIN Putative tyrosine-protein phosphatase auxilin OS=Bos taurus GN=DNAJC6 PE=1 SV=1 Back     alignment and function description
>sp|Q80TZ3|AUXI_MOUSE Putative tyrosine-protein phosphatase auxilin OS=Mus musculus GN=Dnajc6 PE=2 SV=2 Back     alignment and function description
>sp|P97874|GAK_RAT Cyclin-G-associated kinase OS=Rattus norvegicus GN=Gak PE=2 SV=1 Back     alignment and function description
>sp|Q99KY4|GAK_MOUSE Cyclin-G-associated kinase OS=Mus musculus GN=Gak PE=1 SV=2 Back     alignment and function description
>sp|O14976|GAK_HUMAN Cyclin-G-associated kinase OS=Homo sapiens GN=GAK PE=1 SV=2 Back     alignment and function description
>sp|O13773|UCP7_SCHPO UBA domain-containing protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ucp7 PE=4 SV=1 Back     alignment and function description
>sp|Q9SU08|AUXI1_ARATH Auxilin-related protein 1 OS=Arabidopsis thaliana GN=At4g12780 PE=1 SV=2 Back     alignment and function description
>sp|Q0WQ57|AUXI2_ARATH Auxilin-related protein 2 OS=Arabidopsis thaliana GN=At4g12770 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query76
91090196 1123 PREDICTED: similar to AGAP003715-PA [Tri 0.802 0.054 0.727 3e-20
156537582 1205 PREDICTED: cyclin-G-associated kinase-li 0.789 0.049 0.698 2e-18
170044846 1194 cyclin G-associated kinase [Culex quinqu 0.671 0.042 0.788 3e-18
312373769 1344 hypothetical protein AND_17024 [Anophele 0.671 0.037 0.788 6e-18
194741626 1197 GF17690 [Drosophila ananassae] gi|190626 0.671 0.042 0.730 7e-18
195036290 1207 GH18708 [Drosophila grimshawi] gi|193893 0.657 0.041 0.764 7e-18
195400222 1212 GJ14155 [Drosophila virilis] gi|19414227 0.671 0.042 0.730 9e-18
157109838 1135 hypothetical protein AaeL_AAEL005425 [Ae 0.671 0.044 0.75 2e-17
194898368 1174 GG12187 [Drosophila erecta] gi|190650489 0.671 0.043 0.711 2e-17
347970471 1287 AGAP003715-PA [Anopheles gambiae str. PE 0.671 0.039 0.769 2e-17
>gi|91090196|ref|XP_967193.1| PREDICTED: similar to AGAP003715-PA [Tribolium castaneum] gi|270013468|gb|EFA09916.1| hypothetical protein TcasGA2_TC012067 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 48/66 (72%), Positives = 54/66 (81%), Gaps = 5/66 (7%)

Query: 15   RKACLAVHPD----KILEWTEGKKGNIRALLCSLHTILWEGAKW-KCEMSQLVTPADVKK 69
            RK  +A + D    KI+EW EGKK NIRALLCSLHT+LWEG KW KC+MSQLVTPADVKK
Sbjct: 1015 RKEDMATYMDPDKIKIMEWKEGKKNNIRALLCSLHTVLWEGTKWNKCDMSQLVTPADVKK 1074

Query: 70   SYRKAC 75
            +YRKAC
Sbjct: 1075 AYRKAC 1080




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|156537582|ref|XP_001607688.1| PREDICTED: cyclin-G-associated kinase-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|170044846|ref|XP_001850042.1| cyclin G-associated kinase [Culex quinquefasciatus] gi|167867967|gb|EDS31350.1| cyclin G-associated kinase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|312373769|gb|EFR21458.1| hypothetical protein AND_17024 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|194741626|ref|XP_001953290.1| GF17690 [Drosophila ananassae] gi|190626349|gb|EDV41873.1| GF17690 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195036290|ref|XP_001989604.1| GH18708 [Drosophila grimshawi] gi|193893800|gb|EDV92666.1| GH18708 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195400222|ref|XP_002058717.1| GJ14155 [Drosophila virilis] gi|194142277|gb|EDW58685.1| GJ14155 [Drosophila virilis] Back     alignment and taxonomy information
>gi|157109838|ref|XP_001650843.1| hypothetical protein AaeL_AAEL005425 [Aedes aegypti] gi|108878880|gb|EAT43105.1| AAEL005425-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|194898368|ref|XP_001978786.1| GG12187 [Drosophila erecta] gi|190650489|gb|EDV47744.1| GG12187 [Drosophila erecta] Back     alignment and taxonomy information
>gi|347970471|ref|XP_310244.7| AGAP003715-PA [Anopheles gambiae str. PEST] gi|333466689|gb|EAA06048.5| AGAP003715-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query76
FB|FBgn00372181165 aux "auxillin" [Drosophila mel 0.671 0.043 0.692 1.2e-16
UNIPROTKB|F1NC601225 Gga.54538 "Uncharacterized pro 0.657 0.040 0.673 1e-11
UNIPROTKB|F1NL761265 Gga.54538 "Uncharacterized pro 0.657 0.039 0.673 1.1e-11
UNIPROTKB|F1NC571266 Gga.54538 "Uncharacterized pro 0.657 0.039 0.673 1.1e-11
UNIPROTKB|F1MIB21268 GAK "Uncharacterized protein" 0.657 0.039 0.634 3.2e-11
ZFIN|ZDB-GENE-080104-2903 dnajc6 "DnaJ (Hsp40) homolog, 0.657 0.055 0.634 3.8e-11
UNIPROTKB|Q27974910 DNAJC6 "Putative tyrosine-prot 0.657 0.054 0.653 3.9e-11
UNIPROTKB|O75061913 DNAJC6 "Putative tyrosine-prot 0.657 0.054 0.653 3.9e-11
UNIPROTKB|F1PGG91304 GAK "Uncharacterized protein" 0.657 0.038 0.615 4.8e-11
MGI|MGI:1919935938 Dnajc6 "DnaJ (Hsp40) homolog, 0.657 0.053 0.634 8.5e-11
FB|FBgn0037218 aux "auxillin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 219 (82.2 bits), Expect = 1.2e-16, P = 1.2e-16
 Identities = 36/52 (69%), Positives = 47/52 (90%)

Query:    25 KILEWTEGKKGNIRALLCSLHTILWEGAKW-KCEMSQLVTPADVKKSYRKAC 75
             +I+EWT+GKK NIRALLCS+HT+LW+ AKW +CEMS +VTP +VKK+YR+AC
Sbjct:  1071 RIMEWTDGKKNNIRALLCSMHTVLWDNAKWQRCEMSTMVTPTEVKKAYRRAC 1122


GO:0016191 "synaptic vesicle uncoating" evidence=TAS
GO:0006468 "protein phosphorylation" evidence=IEA;NAS
GO:0004672 "protein kinase activity" evidence=NAS
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0007219 "Notch signaling pathway" evidence=IMP
GO:0001745 "compound eye morphogenesis" evidence=IMP
GO:0005795 "Golgi stack" evidence=IDA
GO:0007291 "sperm individualization" evidence=IMP
UNIPROTKB|F1NC60 Gga.54538 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NL76 Gga.54538 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NC57 Gga.54538 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MIB2 GAK "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080104-2 dnajc6 "DnaJ (Hsp40) homolog, subfamily C, member 6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q27974 DNAJC6 "Putative tyrosine-protein phosphatase auxilin" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O75061 DNAJC6 "Putative tyrosine-protein phosphatase auxilin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PGG9 GAK "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1919935 Dnajc6 "DnaJ (Hsp40) homolog, subfamily C, member 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O13773UCP7_SCHPONo assigned EC number0.520.64470.0703yesN/A
O75061AUXI_HUMAN3, ., 1, ., 3, ., 4, 80.65380.65780.0547yesN/A
Q80TZ3AUXI_MOUSE3, ., 1, ., 3, ., 4, 80.63460.65780.0533yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query76
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 9e-05
pfam0022663 pfam00226, DnaJ, DnaJ domain 2e-04
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 4e-04
PHA02624 647 PHA02624, PHA02624, large T antigen; Provisional 0.003
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 0.004
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
 Score = 36.0 bits (84), Expect = 9e-05
 Identities = 10/20 (50%), Positives = 14/20 (70%)

Query: 6  TPADVKKSYRKACLAVHPDK 25
          +  ++KK+YRK  L  HPDK
Sbjct: 13 SDEEIKKAYRKLALKYHPDK 32


DnaJ/Hsp40 (heat shock protein 40) proteins are highly conserved and play crucial roles in protein translation, folding, unfolding, translocation, and degradation. They act primarily by stimulating the ATPase activity of Hsp70s, an important chaperonine family. Hsp40 proteins are characterized by the presence of a J domain, which mediates the interaction with Hsp70. They may contain other domains as well, and the architectures provide a means of classification. Length = 55

>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|222912 PHA02624, PHA02624, large T antigen; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 76
KOG0431|consensus453 99.91
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.12
KOG0713|consensus 336 99.04
PRK14288 369 chaperone protein DnaJ; Provisional 98.85
KOG0712|consensus 337 98.77
PRK14296 372 chaperone protein DnaJ; Provisional 98.75
PRK14279 392 chaperone protein DnaJ; Provisional 98.7
PRK14282 369 chaperone protein DnaJ; Provisional 98.68
PRK14286 372 chaperone protein DnaJ; Provisional 98.67
PRK14283 378 chaperone protein DnaJ; Provisional 98.67
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 98.66
PRK14287 371 chaperone protein DnaJ; Provisional 98.65
PTZ00037 421 DnaJ_C chaperone protein; Provisional 98.62
KOG0716|consensus 279 98.62
PRK14299 291 chaperone protein DnaJ; Provisional 98.62
PRK14295 389 chaperone protein DnaJ; Provisional 98.61
PRK14285 365 chaperone protein DnaJ; Provisional 98.61
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 98.61
PRK14278 378 chaperone protein DnaJ; Provisional 98.59
PRK14291 382 chaperone protein DnaJ; Provisional 98.59
PRK14284 391 chaperone protein DnaJ; Provisional 98.59
PRK14294 366 chaperone protein DnaJ; Provisional 98.59
PRK14290 365 chaperone protein DnaJ; Provisional 98.58
KOG0691|consensus 296 98.58
PRK14280 376 chaperone protein DnaJ; Provisional 98.57
PRK14276 380 chaperone protein DnaJ; Provisional 98.57
PRK14277 386 chaperone protein DnaJ; Provisional 98.56
PRK14298 377 chaperone protein DnaJ; Provisional 98.56
PRK14297 380 chaperone protein DnaJ; Provisional 98.56
PRK10767 371 chaperone protein DnaJ; Provisional 98.54
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 98.54
PRK14301 373 chaperone protein DnaJ; Provisional 98.54
PHA03102153 Small T antigen; Reviewed 98.51
PRK14281 397 chaperone protein DnaJ; Provisional 98.5
KOG0717|consensus 508 98.5
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 98.49
PRK14300 372 chaperone protein DnaJ; Provisional 98.49
PRK10266 306 curved DNA-binding protein CbpA; Provisional 98.48
PRK14289 386 chaperone protein DnaJ; Provisional 98.42
KOG0715|consensus 288 98.41
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 98.39
PRK14292 371 chaperone protein DnaJ; Provisional 98.38
PRK14293 374 chaperone protein DnaJ; Provisional 98.37
COG2214 237 CbpA DnaJ-class molecular chaperone [Posttranslati 98.32
KOG0718|consensus 546 98.32
KOG0721|consensus230 98.28
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 98.27
KOG0719|consensus 264 98.26
PTZ00100116 DnaJ chaperone protein; Provisional 98.24
KOG0722|consensus 329 98.14
KOG0431|consensus453 98.03
PHA02624 647 large T antigen; Provisional 97.89
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 97.88
KOG0550|consensus486 97.69
KOG0714|consensus 306 97.68
KOG1150|consensus 250 97.52
KOG0720|consensus 490 97.52
PRK05014171 hscB co-chaperone HscB; Provisional 97.4
PRK01356166 hscB co-chaperone HscB; Provisional 97.21
PRK03578176 hscB co-chaperone HscB; Provisional 97.2
PRK00294173 hscB co-chaperone HscB; Provisional 97.08
KOG0624|consensus504 96.98
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 96.87
KOG1789|consensus 2235 96.57
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 96.12
PRK01773173 hscB co-chaperone HscB; Provisional 94.37
KOG0723|consensus112 93.03
KOG0568|consensus 342 92.7
PF14687112 DUF4460: Domain of unknown function (DUF4460) 90.08
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 85.63
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 85.29
>KOG0431|consensus Back     alignment and domain information
Probab=99.91  E-value=3.1e-25  Score=171.65  Aligned_cols=61  Identities=49%  Similarity=0.889  Sum_probs=57.9

Q ss_pred             HHHHHhCCC--CcccchhchHHHHHHHHHhhhhhhcCCCCc-cccccccCCchhHHHHHHhhcC
Q psy5338          16 KACLAVHPD--KILEWTEGKKGNIRALLCSLHTILWEGAKW-KCEMSQLVTPADVKKSYRKACT   76 (76)
Q Consensus        16 ~~a~~~hPD--Ki~~W~e~ke~n~R~LL~~l~~vLw~~~~w-~v~~~~l~~~~~vK~~y~ka~~   76 (76)
                      ++++.+.|.  +|..|.+|+++|||+||+|||.|||++++| +|||+|||+|++|||+||||||
T Consensus       351 e~~r~~e~~d~~I~~W~~GKE~NIRALLSTLh~VLW~es~WqpVsltDLVtp~~VKKaYrKA~L  414 (453)
T KOG0431|consen  351 ELSRLMEPLDEEIRRWSEGKEGNIRALLSTLHYVLWPESGWQPVSLTDLVTPAQVKKAYRKAVL  414 (453)
T ss_pred             HHHhhcchHHHHHHHhcccccccHHHHHHHHhHhhcCccCcccCchhhccCHHHHHHHHHhhhh
Confidence            457888885  899999999999999999999999999999 9999999999999999999997



>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0713|consensus Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0712|consensus Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>KOG0716|consensus Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691|consensus Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0717|consensus Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715|consensus Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0718|consensus Back     alignment and domain information
>KOG0721|consensus Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>KOG0719|consensus Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>KOG0722|consensus Back     alignment and domain information
>KOG0431|consensus Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>KOG0714|consensus Back     alignment and domain information
>KOG1150|consensus Back     alignment and domain information
>KOG0720|consensus Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>KOG1789|consensus Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0723|consensus Back     alignment and domain information
>KOG0568|consensus Back     alignment and domain information
>PF14687 DUF4460: Domain of unknown function (DUF4460) Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query76
1n4c_A182 Nmr Structure Of The J-Domain And Clathrin Substrat 3e-12
1xi5_J114 Clathrin D6 Coat With Auxilin J-Domain Length = 114 4e-12
2qwo_B92 Crystal Structure Of Disulfide-Bond-Crosslinked Com 9e-12
2qwn_B94 Crystal Structure Of Disulfide-Bond-Crosslinked Com 9e-12
1nz6_A101 Crystal Structure Of Auxilin J-Domain Length = 101 9e-11
3ag7_A106 An Auxilin-Like J-Domain Containing Protein, Jac1 J 3e-07
>pdb|1N4C|A Chain A, Nmr Structure Of The J-Domain And Clathrin Substrate Binding Domain Of Bovine Auxilin Length = 182 Back     alignment and structure

Iteration: 1

Score = 66.6 bits (161), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 34/53 (64%), Positives = 39/53 (73%), Gaps = 2/53 (3%) Query: 25 KILEWTEGKKGNIRALLCSLHTILWEG-AKWK-CEMSQLVTPADVKKSYRKAC 75 KILEW EGK+ NIRALL ++HT+LW G KWK M+ LVTP VKK YRKA Sbjct: 90 KILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAV 142
>pdb|1XI5|J Chain J, Clathrin D6 Coat With Auxilin J-Domain Length = 114 Back     alignment and structure
>pdb|2QWO|B Chain B, Crystal Structure Of Disulfide-Bond-Crosslinked Complex Of Bovine Hsc70 (1-394aa)r171c And Bovine Auxilin (810-910aa)d876c In The AdpPi Form #1 Length = 92 Back     alignment and structure
>pdb|2QWN|B Chain B, Crystal Structure Of Disulfide-Bond-Crosslinked Complex Of Bovine Hsc70 (1-386aa)r171c And Bovine Auxilin (810-910aa)d876c In The AdpPi State Length = 94 Back     alignment and structure
>pdb|1NZ6|A Chain A, Crystal Structure Of Auxilin J-Domain Length = 101 Back     alignment and structure
>pdb|3AG7|A Chain A, An Auxilin-Like J-Domain Containing Protein, Jac1 J-Domain Length = 106 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query76
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 9e-19
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 4e-07
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 3e-17
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 4e-07
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 1e-16
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 9e-07
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
 Score = 72.3 bits (177), Expect = 9e-19
 Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 24 DKILEWTEGKKGNIRALLCSLHTILWEGAKWK-CEMSQLVTPADVKKSYRKAC 75
           KI +W+ GK GNIR+LL +L  ILW G+ WK   +  ++    V+KSY++A 
Sbjct: 13 AKIRKWSSGKSGNIRSLLSTLQYILWSGSGWKPVPLMDMIEGNAVRKSYQRAL 65


>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query76
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.51
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.28
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.1
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 98.98
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 98.97
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 98.96
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 98.86
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 98.84
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 98.83
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 98.83
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 98.82
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 98.79
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 98.79
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 98.78
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 98.75
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 98.72
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 98.7
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 98.7
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 98.7
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 98.69
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 98.68
3apq_A 210 DNAJ homolog subfamily C member 10; thioredoxin fo 98.64
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 98.63
2guz_A71 Mitochondrial import inner membrane translocase su 98.62
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 98.6
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 98.54
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 98.53
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 98.46
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 98.45
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 98.33
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 98.22
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 98.19
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 98.18
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 98.11
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 98.11
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 97.96
2guz_B65 Mitochondrial import inner membrane translocase su 97.64
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 96.37
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 85.16
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
Probab=99.51  E-value=2.8e-15  Score=94.31  Aligned_cols=52  Identities=63%  Similarity=1.105  Sum_probs=49.5

Q ss_pred             CcccchhchHHHHHHHHHhhhhhhcCC-CCc-cccccccCCchhHHHHHHhhcC
Q psy5338          25 KILEWTEGKKGNIRALLCSLHTILWEG-AKW-KCEMSQLVTPADVKKSYRKACT   76 (76)
Q Consensus        25 Ki~~W~e~ke~n~R~LL~~l~~vLw~~-~~w-~v~~~~l~~~~~vK~~y~ka~~   76 (76)
                      ||..|++|+++|+|+||++|+.|||+| +.| .++++...++.+||++|||+.+
T Consensus         6 ~i~~W~~gk~~~ir~lL~~l~~~L~~~~~~y~~Lgv~~~as~~eIKkAYRklal   59 (92)
T 2qwo_B            6 KILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVL   59 (92)
T ss_dssp             HHHHHHHHHTTCHHHHHHHGGGTSCTTCCSCCCCCGGGSSSHHHHHHHHHHHHH
T ss_pred             HHHHHHccChhHHHHHHHHHHHHhcccccCCeecCCCCCCCHHHHHHHHHHHHH
Confidence            789999999999999999999999997 899 9999999999999999999863



>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 76
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 3e-16
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 0.003
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: Auxilin J-domain
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 64.6 bits (157), Expect = 3e-16
 Identities = 34/54 (62%), Positives = 39/54 (72%), Gaps = 2/54 (3%)

Query: 24 DKILEWTEGKKGNIRALLCSLHTILWEG-AKWK-CEMSQLVTPADVKKSYRKAC 75
           KILEW EGK+ NIRALL ++HT+LW G  KWK   M+ LVTP  VKK YRKA 
Sbjct: 5  LKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAV 58


>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query76
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.49
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 98.95
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 98.92
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 98.64
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 98.6
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 98.6
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 98.54
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 98.51
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 98.31
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: Auxilin J-domain
species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.49  E-value=2.2e-15  Score=93.71  Aligned_cols=51  Identities=65%  Similarity=1.135  Sum_probs=48.5

Q ss_pred             CcccchhchHHHHHHHHHhhhhhhcCC-CCc-cccccccCCchhHHHHHHhhc
Q psy5338          25 KILEWTEGKKGNIRALLCSLHTILWEG-AKW-KCEMSQLVTPADVKKSYRKAC   75 (76)
Q Consensus        25 Ki~~W~e~ke~n~R~LL~~l~~vLw~~-~~w-~v~~~~l~~~~~vK~~y~ka~   75 (76)
                      ||.+|++|+++|+|+||++|++|||+| ..| +++|++++++.+||++|++++
T Consensus         6 ~i~~W~~~~~~~ir~lL~~l~~vl~~~~~~y~~Lgl~~~~t~~eIk~aYr~l~   58 (98)
T d1nz6a_           6 KILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAV   58 (98)
T ss_dssp             HHHHHHTTTTTCHHHHHTTGGGTSCTTCCSCCCCCGGGCCSHHHHHHHHHHHH
T ss_pred             HHHHHHhcchhhHHHHHHhhhhhcCCcccCCeecCCCccCCHHHHHHHHHHHH
Confidence            788999999999999999999999997 589 999999999999999999986



>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure