Diaphorina citri psyllid: psy5339

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------48

CIQISCLTASPTQLLLQFLDLTDCSCIQISCLTASPTQLLLQFLDLTDCSNVDDQGLSLIVSNCPQLIYLYLRRCVKLTDIGIKYVPSFCSQLKELSVSDCTQVTDFGLYELAKLGATLRYLSVAKCDQVSDAGLKVIARRCYKLRYLNARGCEAVSDDAITVLARSCTRLRALDIGKCDVSDAGLRALAESCPNIKKLSLRQCDLVTDRGVQCIAYYCRGLQQLNIQDCQISVEGYRAVKKYCKRCCIQISCLTASPTQLLLQFLDLTDCSNVDDQGLSLIVSNCPQLIYLYLRRCVKLTDIGIKYVPSFCSQLKELSVSDCTQVTDFGLYELAKLGATLRYLSVAKCDQVSDAGLKVIARRCYKLRYLNARGCEAVSDDAITVLARSCTRLRALDIGKCDVSDAGLRALAESCPNIKKLSLRQCDLVTDRGVQCIAYYCRGLQQLNIQDCQISVEGYRAVKKYCKRCIIEHTNPAFF

cccccccccccccccccEEECcccccccHHHHHcccccccccEEECcccccccHHHHHHHHHccccccEEEEcccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEEcccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEECccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEECccccccHHHHHHHHHHcccccccccccccccccccccEEEccccccccHHHHHHHHcccccccEEEEcccccccHHHHHHHHcccccccEEEECccccccHHHHHHHHHccccccEEEEcccccccHHHHHHHHHccccccEEECcccccccHHHHHHHHHccccccEEEEccccccHHHHHHHHHccccccEEEEcccccccHHHHHHHHHccccccEEEECcccccHHHHHHHHHHcccccccccccccc

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
F-box/LRR-repeat protein 7	Substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of AURKA during mitosis, causing mitotic arrest.	confident	Q9UJT9
F-box/LRR-repeat protein 4		confident	Q9C5D2
F-box/LRR-repeat protein 7	Substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of AURKA during mitosis, causing mitotic arrest.	confident	Q5BJ29

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0004842 [MF]	ubiquitin-protein ligase activity	probable	GO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0000086 [BP]	G2/M transition of mitotic cell cycle	probable	GO:0000278, GO:0008150, GO:0009987, GO:0044770, GO:0044772, GO:0044763, GO:0044699, GO:0022402, GO:0007049
GO:0016020 [CC]	membrane	probable	GO:0005575
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0016567 [BP]	protein ubiquitination	probable	GO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0032446, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0006511 [BP]	ubiquitin-dependent protein catabolic process	probable	GO:0051603, GO:1901575, GO:0044265, GO:0044260, GO:0044267, GO:0019538, GO:0009056, GO:0009987, GO:0019941, GO:0044237, GO:0043170, GO:0044248, GO:0071704, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0006508, GO:0043632, GO:0044238, GO:0009057
GO:0019005 [CC]	SCF ubiquitin ligase complex	probable	GO:0043234, GO:0032991, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031461
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0005813 [CC]	centrosome	probable	GO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3E4G, chain A
Confidence level:very confident
Coverage over the Query: 366-472
View the alignment between query and template
View the model in PyMOL

Template: 3E4G, chain A
Confidence level:very confident
Coverage over the Query: 340-433
View the alignment between query and template
View the model in PyMOL

Template: 2P1M, chain B
Confidence level:very confident
Coverage over the Query: 13-244,261-453
View the alignment between query and template
View the model in PyMOL

Template: 2Z81, chain A
Confidence level:confident
Coverage over the Query: 15-457
View the alignment between query and template
View the model in PyMOL