Psyllid ID: psy5339

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------48
CIQISCLTASPTQLLLQFLDLTDCSCIQISCLTASPTQLLLQFLDLTDCSNVDDQGLSLIVSNCPQLIYLYLRRCVKLTDIGIKYVPSFCSQLKELSVSDCTQVTDFGLYELAKLGATLRYLSVAKCDQVSDAGLKVIARRCYKLRYLNARGCEAVSDDAITVLARSCTRLRALDIGKCDVSDAGLRALAESCPNIKKLSLRQCDLVTDRGVQCIAYYCRGLQQLNIQDCQISVEGYRAVKKYCKRCCIQISCLTASPTQLLLQFLDLTDCSNVDDQGLSLIVSNCPQLIYLYLRRCVKLTDIGIKYVPSFCSQLKELSVSDCTQVTDFGLYELAKLGATLRYLSVAKCDQVSDAGLKVIARRCYKLRYLNARGCEAVSDDAITVLARSCTRLRALDIGKCDVSDAGLRALAESCPNIKKLSLRQCDLVTDRGVQCIAYYCRGLQQLNIQDCQISVEGYRAVKKYCKRCIIEHTNPAFF
cccccccccccccccccEEEEcccccccHHHHHcccccccccEEEEcccccccHHHHHHHHHccccccEEEEcccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEEcccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEEccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEEccccccHHHHHHHHHHcccccccccccccccccccccEEEccccccccHHHHHHHHcccccccEEEEcccccccHHHHHHHHcccccccEEEEEccccccHHHHHHHHHccccccEEEEcccccccHHHHHHHHHccccccEEEEcccccccHHHHHHHHHccccccEEEEccccccHHHHHHHHHccccccEEEEcccccccHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHcccccccccccccc
cccccHHHHHHHcccccEEEccccccccHHHHHHHHccccccEEEccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHHcccccEEEcccccccHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHcccccccHHHHHHHcccccccEEEccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHccccccEEEEccccccHHHHHHHHHHccccEEEEEccccc
ciqiscltasptQLLLQFldltdcsciqiscltasptQLLLQFldltdcsnvddqglslivsncpQLIYLYLRRCVKLTDIGIKYVPSFCsqlkelsvsdctqvtdFGLYELAKLGATLRYLSVAKCDQVSDAGLKVIARRCYKLRylnargceavsdDAITVLARSCTRLraldigkcdvsdAGLRALAESCPNIKKLSLRQCDLVTDRGVQCIAYYCRGlqqlniqdcqISVEGYRAVKKYCKRcciqiscltasptQLLLQFldltdcsnvddqglslivsncpQLIYLYLRRCVKLTDIGIKYVPSFCsqlkelsvsdctqvtdFGLYELAKLGATLRYLSVAKCDQVSDAGLKVIARRCYKLRylnargceavsdDAITVLARSCTRLraldigkcdvsdAGLRALAESCPNIKKLSLRQCDLVTDRGVQCIAYYCRGlqqlniqdcqISVEGYRAVKKYCKRCiiehtnpaff
ciqiscltaspTQLLLQFLDLTDCSCIQISCLTASPTQLLLQFLDLTDCSNVDDQGLSLIVSNCPQLIYLYLRRCVKLTDIGIKYVPSFCSQLKELSVSDCTQVTDFGLYELAKLGATLRYLSVAKCDQVSDAGLKVIARRCYKLRYLnargceavsddAITVLARSCTRLRALDIGKCDVSDAGLRALAESCPNIKKLSLRQCDLVTDRGVQCIAYYCRGLQQLNIQDCQISVEGYRAVKKYCKRCCIQISCLTASPTQLLLQFLDLTDCSNVDDQGLSLIVSNCPQLIYLYLRRCVKLTDIGIKYVPSFCSQLKELSVSDCTQVTDFGLYELAKLGATLRYLSVAKCDQVSDAGLKVIARRCYKLRYLnargceavsddAITVLARSCTRLRALDIGKCDVSDAGLRALAESCPNIKKLSLRQCDLVTDRGVQCIAYYCRGLQQLNIQDCQISVEGYRAVKKYCKRCIIEHTNPAFF
CIQISCLTASPtqlllqfldltdCSCIQISCLTASPtqlllqfldltdCSNVDDQGLSLIVSNCPQLIYLYLRRCVKLTDIGIKYVPSFCSQLKELSVSDCTQVTDFGLYELAKLGATLRYLSVAKCDQVSDAGLKVIARRCYKLRYLNARGCEAVSDDAITVLARSCTRLRALDIGKCDVSDAGLRALAESCPNIKKLSLRQCDLVTDRGVQCIAYYCRGLQQLNIQDCQISVEGYRAVKKYCKRCCIQISCLTASPtqlllqfldltdCSNVDDQGLSLIVSNCPQLIYLYLRRCVKLTDIGIKYVPSFCSQLKELSVSDCTQVTDFGLYELAKLGATLRYLSVAKCDQVSDAGLKVIARRCYKLRYLNARGCEAVSDDAITVLARSCTRLRALDIGKCDVSDAGLRALAESCPNIKKLSLRQCDLVTDRGVQCIAYYCRGLQQLNIQDCQISVEGYRAVKKYCKRCIIEHTNPAFF
**QISCLTASPTQLLLQFLDLTDCSCIQISCLTASPTQLLLQFLDLTDCSNVDDQGLSLIVSNCPQLIYLYLRRCVKLTDIGIKYVPSFCSQLKELSVSDCTQVTDFGLYELAKLGATLRYLSVAKCDQVSDAGLKVIARRCYKLRYLNARGCEAVSDDAITVLARSCTRLRALDIGKCDVSDAGLRALAESCPNIKKLSLRQCDLVTDRGVQCIAYYCRGLQQLNIQDCQISVEGYRAVKKYCKRCCIQISCLTASPTQLLLQFLDLTDCSNVDDQGLSLIVSNCPQLIYLYLRRCVKLTDIGIKYVPSFCSQLKELSVSDCTQVTDFGLYELAKLGATLRYLSVAKCDQVSDAGLKVIARRCYKLRYLNARGCEAVSDDAITVLARSCTRLRALDIGKCDVSDAGLRALAESCPNIKKLSLRQCDLVTDRGVQCIAYYCRGLQQLNIQDCQISVEGYRAVKKYCKRCIIEHT*****
CIQISCLTASPTQLLLQFLDLTDCSCIQISCLTASPTQLLLQFLDLTDCSNVDDQGLSLIVSNCPQLIYLYLRRCVKLTDIGIKYVPSFCSQLKELSVSDCTQVTDFGLYELAKLGATLRYLSVAKCDQVSDAGLKVIARRCYKLRYLNARGCEAVSDDAITVLARSCTRLRALDIGKCDVSDAGLRALAESCPNIKKLSLRQCDLVTDRGVQCIAYYCRGLQQLNIQDCQISVEGYRAVKKYCKRCCIQISCLTASPTQLLLQFLDLTDCSNVDDQGLSLIVSNCPQLIYLYLRRCVKLTDIGIKYVPSFCSQLKELSVSDCTQVTDFGLYELAKLGATLRYLSVAKCDQVSDAGLKVIARRCYKLRYLNARGCEAVSDDAITVLARSCTRLRALDIGKCDVSDAGLRALAESCPNIKKLSLRQCDLVTDRGVQCIAYYCRGLQQLNIQDCQISVEGYRAVKKYCKRCIIEHTNPAFF
CIQISCLTASPTQLLLQFLDLTDCSCIQISCLTASPTQLLLQFLDLTDCSNVDDQGLSLIVSNCPQLIYLYLRRCVKLTDIGIKYVPSFCSQLKELSVSDCTQVTDFGLYELAKLGATLRYLSVAKCDQVSDAGLKVIARRCYKLRYLNARGCEAVSDDAITVLARSCTRLRALDIGKCDVSDAGLRALAESCPNIKKLSLRQCDLVTDRGVQCIAYYCRGLQQLNIQDCQISVEGYRAVKKYCKRCCIQISCLTASPTQLLLQFLDLTDCSNVDDQGLSLIVSNCPQLIYLYLRRCVKLTDIGIKYVPSFCSQLKELSVSDCTQVTDFGLYELAKLGATLRYLSVAKCDQVSDAGLKVIARRCYKLRYLNARGCEAVSDDAITVLARSCTRLRALDIGKCDVSDAGLRALAESCPNIKKLSLRQCDLVTDRGVQCIAYYCRGLQQLNIQDCQISVEGYRAVKKYCKRCIIEHTNPAFF
CIQISCLTASPTQLLLQFLDLTDCSCIQISCLTASPTQLLLQFLDLTDCSNVDDQGLSLIVSNCPQLIYLYLRRCVKLTDIGIKYVPSFCSQLKELSVSDCTQVTDFGLYELAKLGATLRYLSVAKCDQVSDAGLKVIARRCYKLRYLNARGCEAVSDDAITVLARSCTRLRALDIGKCDVSDAGLRALAESCPNIKKLSLRQCDLVTDRGVQCIAYYCRGLQQLNIQDCQISVEGYRAVKKYCKRCCIQISCLTASPTQLLLQFLDLTDCSNVDDQGLSLIVSNCPQLIYLYLRRCVKLTDIGIKYVPSFCSQLKELSVSDCTQVTDFGLYELAKLGATLRYLSVAKCDQVSDAGLKVIARRCYKLRYLNARGCEAVSDDAITVLARSCTRLRALDIGKCDVSDAGLRALAESCPNIKKLSLRQCDLVTDRGVQCIAYYCRGLQQLNIQDCQISVEGYRAVKKYCKRCIIEHTNPAFF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CIQISCLTASPTQLLLQFLDLTDCSCIQISCLTASPTQLLLQFLDLTDCSNVDDQGLSLIVSNCPQLIYLYLRRCVKLTDIGIKYVPSFCSQLKELSVSDCTQVTDFGLYELAKLGATLRYLSVAKCDQVSDAGLKVIARRCYKLRYLNARGCEAVSDDAITVLARSCTRLRALDIGKCDVSDAGLRALAESCPNIKKLSLRQCDLVTDRGVQCIAYYCRGLQQLNIQDCQISVEGYRAVKKYCKRCCIQISCLTASPTQLLLQFLDLTDCSNVDDQGLSLIVSNCPQLIYLYLRRCVKLTDIGIKYVPSFCSQLKELSVSDCTQVTDFGLYELAKLGATLRYLSVAKCDQVSDAGLKVIARRCYKLRYLNARGCEAVSDDAITVLARSCTRLRALDIGKCDVSDAGLRALAESCPNIKKLSLRQCDLVTDRGVQCIAYYCRGLQQLNIQDCQISVEGYRAVKKYCKRCIIEHTNPAFF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query479 2.2.26 [Sep-21-2011]
Q9UJT9491 F-box/LRR-repeat protein yes N/A 0.657 0.641 0.427 2e-76
Q5BJ29491 F-box/LRR-repeat protein yes N/A 0.657 0.641 0.424 2e-76
A1A5X2489 F-box/LRR-repeat protein yes N/A 0.651 0.638 0.437 2e-74
Q9C5D2610 F-box/LRR-repeat protein yes N/A 0.855 0.672 0.312 3e-44
Q96IG2436 F-box/LRR-repeat protein no N/A 0.643 0.706 0.292 3e-39
Q58DG6436 F-box/LRR-repeat protein no N/A 0.643 0.706 0.292 3e-39
Q9CZV8436 F-box/LRR-repeat protein no N/A 0.643 0.706 0.289 2e-38
Q9SKK0628 EIN3-binding F-box protei no N/A 0.822 0.627 0.281 1e-36
A6H779423 F-box/LRR-repeat protein no N/A 0.632 0.716 0.309 7e-36
Q8BH16423 F-box/LRR-repeat protein no N/A 0.624 0.706 0.306 2e-35
>sp|Q9UJT9|FBXL7_HUMAN F-box/LRR-repeat protein 7 OS=Homo sapiens GN=FBXL7 PE=2 SV=1 Back     alignment and function desciption
 Score =  286 bits (733), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 153/358 (42%), Positives = 225/358 (62%), Gaps = 43/358 (12%)

Query: 132 DAGLKVIARR--------CYKLRYLNARGCEAVSDDAITVLARSCTRLRALDIGKC-DVS 182
           D  LKV+ RR        C  L  +   GC  ++D  +  +A+ C  LR L++  C ++S
Sbjct: 167 DRALKVLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNIS 226

Query: 183 DAGLRALAESCPNIKKLSLRQCDLVTDRGVQCIAYYCRGLQQLNIQDCQISVEGYRAVKK 242
           +  +  +   CPN++ L +  C  VT     CI+                          
Sbjct: 227 NEAVFDVVSLCPNLEHLDVSGCSKVT-----CISL------------------------- 256

Query: 243 YCKRCCIQISCLTASPTQLLLQFLDLTDCSNVDDQGLSLIVSNCPQLIYLYLRRCVKLTD 302
             +   I++S L     Q+ +++LD+TDC  ++D+GL  I ++C QL +LYLRRCV+LTD
Sbjct: 257 -TREASIKLSPLHGK--QISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTD 313

Query: 303 IGIKYVPSFCSQLKELSVSDCTQVTDFGLYELAKLGATLRYLSVAKCDQVSDAGLKVIAR 362
            G++Y+  +C+ +KELSVSDC  V+DFGL E+AKL + LRYLS+A C +V+D G++ +A+
Sbjct: 314 EGLRYLVIYCASIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHCGRVTDVGIRYVAK 373

Query: 363 RCYKLRYLNARGCEAVSDDAITVLARSCTRLRALDIGKCD-VSDAGLRALAESCPNIKKL 421
            C KLRYLNARGCE ++D  +  LA++CT+L++LDIGKC  VSD GL  LA +C N+K+L
Sbjct: 374 YCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGLECLALNCFNLKRL 433

Query: 422 SLRQCDLVTDRGVQCIAYYCRGLQQLNIQDCQISVEGYRAVKKYCKRCIIEHTNPAFF 479
           SL+ C+ +T +G+Q +A  C  LQ LN+QDC++SVE  R VK++CKRC+IEHTNPAFF
Sbjct: 434 SLKSCESITGQGLQIVAANCFDLQTLNVQDCEVSVEALRFVKRHCKRCVIEHTNPAFF 491
Substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of AURKA during mitosis, causing mitotic arrest.
Homo sapiens (taxid: 9606)
>sp|Q5BJ29|FBXL7_MOUSE F-box/LRR-repeat protein 7 OS=Mus musculus GN=Fbxl7 PE=1 SV=1 Back     alignment and function description
>sp|A1A5X2|FBXL7_DANRE F-box/LRR-repeat protein 7 OS=Danio rerio GN=fbxl7 PE=2 SV=1 Back     alignment and function description
>sp|Q9C5D2|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1 Back     alignment and function description
>sp|Q96IG2|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2 Back     alignment and function description
>sp|Q58DG6|FXL20_BOVIN F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2 Back     alignment and function description
>sp|Q9CZV8|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3 Back     alignment and function description
>sp|Q9SKK0|EBF1_ARATH EIN3-binding F-box protein 1 OS=Arabidopsis thaliana GN=EBF1 PE=1 SV=1 Back     alignment and function description
>sp|A6H779|FBXL2_BOVIN F-box/LRR-repeat protein 2 OS=Bos taurus GN=FBXL2 PE=2 SV=1 Back     alignment and function description
>sp|Q8BH16|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query479
195389118 780 GJ23768 [Drosophila virilis] gi|19415131 0.597 0.366 0.687 1e-116
195444896 764 GK11217 [Drosophila willistoni] gi|19416 0.686 0.430 0.598 1e-116
195110169 782 GI22952 [Drosophila mojavensis] gi|19391 0.597 0.365 0.687 1e-115
312372308 850 hypothetical protein AND_20333 [Anophele 0.691 0.389 0.598 1e-115
198453621 787 GA18044 [Drosophila pseudoobscura pseudo 0.597 0.363 0.687 1e-115
195152237 789 GL22080 [Drosophila persimilis] gi|19411 0.597 0.362 0.687 1e-115
195054589 766 GH23468 [Drosophila grimshawi] gi|193896 0.599 0.374 0.683 1e-115
21357913 772 CG4221 [Drosophila melanogaster] gi|1619 0.597 0.370 0.681 1e-115
195080846 746 GH23299 [Drosophila grimshawi] gi|193905 0.599 0.384 0.683 1e-114
195501137 780 GE24351 [Drosophila yakuba] gi|194183775 0.597 0.366 0.677 1e-114
>gi|195389118|ref|XP_002053225.1| GJ23768 [Drosophila virilis] gi|194151311|gb|EDW66745.1| GJ23768 [Drosophila virilis] Back     alignment and taxonomy information
 Score =  425 bits (1092), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 207/301 (68%), Positives = 239/301 (79%), Gaps = 15/301 (4%)

Query: 179 CDVSDAGLRALAESCPNIKKLSLRQCDLVTDRGVQCIAYYCRGLQQLNIQDC-QISVEGY 237
           C +SD GL+ L   CP +  L L+ C+ V+++ +      C  LQ L++  C Q+S    
Sbjct: 493 CRISDKGLQLLTRRCPELTHLQLQTCEGVSNQALVEALTKCSNLQHLDVTGCSQVS---- 548

Query: 238 RAVKKYCKRCCIQISCLTASPTQLLLQFLDLTDCSNVDDQGLSLIVSNCPQLIYLYLRRC 297
                      I  +     P +LLLQ+LDLTDC  +DD GL ++V NCPQL+YLYLRRC
Sbjct: 549 ----------SISPNPHMEPPRRLLLQYLDLTDCMAIDDMGLKIVVKNCPQLVYLYLRRC 598

Query: 298 VKLTDIGIKYVPSFCSQLKELSVSDCTQVTDFGLYELAKLGATLRYLSVAKCDQVSDAGL 357
           +++TD G+K+VPSFC  LKELSVSDC  +TDFGLYELAKLGA LRYLSVAKC++VSDAGL
Sbjct: 599 IQITDAGLKFVPSFCVSLKELSVSDCVNITDFGLYELAKLGAALRYLSVAKCERVSDAGL 658

Query: 358 KVIARRCYKLRYLNARGCEAVSDDAITVLARSCTRLRALDIGKCDVSDAGLRALAESCPN 417
           KVIARRCYKLRYLNARGCEAVSDD+ITVLARSC RLRALDIGKCDVSDAGLRALAESCPN
Sbjct: 659 KVIARRCYKLRYLNARGCEAVSDDSITVLARSCPRLRALDIGKCDVSDAGLRALAESCPN 718

Query: 418 IKKLSLRQCDLVTDRGVQCIAYYCRGLQQLNIQDCQISVEGYRAVKKYCKRCIIEHTNPA 477
           +KKLSLR CD++TDRGVQCIAYYCRGLQQLNIQDCQIS+EGYRAVKKYCKRCIIEHTNP 
Sbjct: 719 LKKLSLRNCDMITDRGVQCIAYYCRGLQQLNIQDCQISIEGYRAVKKYCKRCIIEHTNPG 778

Query: 478 F 478
           F
Sbjct: 779 F 779

Source: Drosophila virilis

Species: Drosophila virilis

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195444896|ref|XP_002070079.1| GK11217 [Drosophila willistoni] gi|194166164|gb|EDW81065.1| GK11217 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195110169|ref|XP_001999654.1| GI22952 [Drosophila mojavensis] gi|193916248|gb|EDW15115.1| GI22952 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|312372308|gb|EFR20294.1| hypothetical protein AND_20333 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|198453621|ref|XP_001359268.2| GA18044 [Drosophila pseudoobscura pseudoobscura] gi|198132440|gb|EAL28413.2| GA18044 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195152237|ref|XP_002017043.1| GL22080 [Drosophila persimilis] gi|194112100|gb|EDW34143.1| GL22080 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|195054589|ref|XP_001994207.1| GH23468 [Drosophila grimshawi] gi|193896077|gb|EDV94943.1| GH23468 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|21357913|ref|NP_650512.1| CG4221 [Drosophila melanogaster] gi|16198189|gb|AAL13904.1| LD38495p [Drosophila melanogaster] gi|23171416|gb|AAF55252.2| CG4221 [Drosophila melanogaster] gi|220947248|gb|ACL86167.1| CG4221-PA [synthetic construct] gi|220956790|gb|ACL90938.1| CG4221-PA [synthetic construct] Back     alignment and taxonomy information
>gi|195080846|ref|XP_001997322.1| GH23299 [Drosophila grimshawi] gi|193905658|gb|EDW04525.1| GH23299 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195501137|ref|XP_002097674.1| GE24351 [Drosophila yakuba] gi|194183775|gb|EDW97386.1| GE24351 [Drosophila yakuba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query479
UNIPROTKB|D6RDY7444 FBXL7 "F-box/LRR-repeat protei 0.636 0.686 0.439 2.9e-71
UNIPROTKB|J3KNM9479 FBXL7 "F-box/LRR-repeat protei 0.636 0.636 0.439 2.9e-71
UNIPROTKB|Q9UJT9491 FBXL7 "F-box/LRR-repeat protei 0.636 0.621 0.439 2.9e-71
MGI|MGI:3052506491 Fbxl7 "F-box and leucine-rich 0.636 0.621 0.436 3.7e-71
RGD|1305813449 Fbxl7 "F-box and leucine-rich 0.636 0.679 0.436 3.7e-71
UNIPROTKB|F1SRM7449 FBXL7 "Uncharacterized protein 0.636 0.679 0.436 6.1e-71
UNIPROTKB|F1N019449 FBXL7 "Uncharacterized protein 0.636 0.679 0.436 9.9e-71
ZFIN|ZDB-GENE-061215-122489 zgc:158346 "zgc:158346" [Danio 0.630 0.617 0.432 2.4e-67
UNIPROTKB|F1NNA4376 FBXL7 "Uncharacterized protein 0.603 0.768 0.410 3.8e-62
TAIR|locus:505006471610 AT4G15475 "AT4G15475" [Arabido 0.835 0.655 0.303 7.9e-46
UNIPROTKB|D6RDY7 FBXL7 "F-box/LRR-repeat protein 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 721 (258.9 bits), Expect = 2.9e-71, P = 2.9e-71
 Identities = 138/314 (43%), Positives = 205/314 (65%)

Query:   168 CTRLRALDIGKCD-VSDAGLRALAESCPNIKKLSLRQCDLVTDRGVQCIAYYCRGLQQLN 226
             C  L  + +  C  ++D GL  +A+ CP +++L +  C  +++  V  +   C  L+ L+
Sbjct:   138 CLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLD 197

Query:   227 IQDCQISVEGYRAVKKYCKRCCIQISCLTASPXXXXXXXXXXXXCSNVDDQGLSLIVSNC 286
             +  C   V      ++      I++S L                C  ++D+GL  I ++C
Sbjct:   198 VSGCS-KVTCISLTRE----ASIKLSPLHGKQISIRYLDMTD--CFVLEDEGLHTIAAHC 250

Query:   287 PQLIYLYLRRCVKLTDIGIKYVPSFCSQLKELSVSDCTQVTDFGLYELAKLGATLRYLSV 346
              QL +LYLRRCV+LTD G++Y+  +C+ +KELSVSDC  V+DFGL E+AKL + LRYLS+
Sbjct:   251 TQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIAKLESRLRYLSI 310

Query:   347 AKCDQVSDAGLKVIARRCYKLRYLNARGCEAVSDDAITVLARSCTRLRALDIGKCD-VSD 405
             A C +V+D G++ +A+ C KLRYLNARGCE ++D  +  LA++CT+L++LDIGKC  VSD
Sbjct:   311 AHCGRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSD 370

Query:   406 AGLRALAESCPNIKKLSLRQCDLVTDRGVQCIAYYCRGLQQLNIQDCQISVEGYRAVKKY 465
              GL  LA +C N+K+LSL+ C+ +T +G+Q +A  C  LQ LN+QDC++SVE  R VK++
Sbjct:   371 TGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVSVEALRFVKRH 430

Query:   466 CKRCIIEHTNPAFF 479
             CKRC+IEHTNPAFF
Sbjct:   431 CKRCVIEHTNPAFF 444
GO:0000086 "G2/M transition of mitotic cell cycle" evidence=IEA
GO:0005813 "centrosome" evidence=IEA
GO:0007067 "mitosis" evidence=IEA
GO:0008283 "cell proliferation" evidence=IEA
GO:0019005 "SCF ubiquitin ligase complex" evidence=IEA
GO:0031146 "SCF-dependent proteasomal ubiquitin-dependent protein catabolic process" evidence=IEA
UNIPROTKB|J3KNM9 FBXL7 "F-box/LRR-repeat protein 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UJT9 FBXL7 "F-box/LRR-repeat protein 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:3052506 Fbxl7 "F-box and leucine-rich repeat protein 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1305813 Fbxl7 "F-box and leucine-rich repeat protein 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1SRM7 FBXL7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1N019 FBXL7 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061215-122 zgc:158346 "zgc:158346" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNA4 FBXL7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
TAIR|locus:505006471 AT4G15475 "AT4G15475" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9UJT9FBXL7_HUMANNo assigned EC number0.42730.65760.6415yesN/A
A1A5X2FBXL7_DANRENo assigned EC number0.43760.65130.6380yesN/A
Q9C5D2FBL4_ARATHNo assigned EC number0.31220.85590.6721yesN/A
P34284YKK7_CAEELNo assigned EC number0.31010.62000.6373yesN/A
Q5BJ29FBXL7_MOUSENo assigned EC number0.42450.65760.6415yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query479
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 6e-25
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 6e-25
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 1e-17
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 5e-15
cd09293 226 cd09293, AMN1, Antagonist of mitotic exit network 1e-06
smart0036726 smart00367, LRR_CC, Leucine-rich repeat - CC (cyst 7e-04
smart0036726 smart00367, LRR_CC, Leucine-rich repeat - CC (cyst 7e-04
smart0036726 smart00367, LRR_CC, Leucine-rich repeat - CC (cyst 0.001
smart0036726 smart00367, LRR_CC, Leucine-rich repeat - CC (cyst 0.001
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information 
 Score =  102 bits (256), Expect = 6e-25
 Identities = 50/178 (28%), Positives = 87/178 (48%), Gaps = 8/178 (4%)

Query: 59  LIVSNCPQLIYLYLRRCVKLTDIGIKYVPSFCSQLKELSVSDCTQVTDFGLYELAKLGAT 118
           L+      L +L L  C            S C++LK+L +     + D GL  LA+    
Sbjct: 22  LLRILHSGLEWLELYMCPISD--PPLDQLSNCNKLKKLILPGSKLIDDEGLIALAQSCPN 79

Query: 119 LRYLSVAKCDQVSDAGLKVIARRCYKLRYLN---ARGCEAVSDDAITVLARSCTRLRALD 175
           L+ L +  C+ ++D+G+  +A  C KL+ +N    R    ++D +++ L ++CT L+ + 
Sbjct: 80  LQVLDLRACENITDSGIVALATNCPKLQTINLGRHRNGHLITDVSLSALGKNCTFLQTVG 139

Query: 176 IGKCDVSDAGLRALAESC-PNIKKLSLRQCDLVTDRGVQCIAY--YCRGLQQLNIQDC 230
              CDV+D G+  LA  C  ++++LSL  C  +TD+ +  I    Y   L  L  + C
Sbjct: 140 FAGCDVTDKGVWELASGCSKSLERLSLNNCRNLTDQSIPAILASNYFPNLSVLEFRGC 197

Amn1 has been functionally characterized in Saccharomyces cerevisiae as a component of the Antagonist of MEN pathway (AMEN). The AMEN network is activated by MEN (mitotic exit network) via an active Cdc14, and in turn switches off MEN. Amn1 constitutes one of the alternative mechanisms by which MEN may be disrupted. Specifically, Amn1 binds Tem1 (Termination of M-phase, a GTPase that belongs to the RAS superfamily), and disrupts its association with Cdc15, the primary downstream target. Amn1 is a leucine-rich repeat (LRR) protein, with 12 repeats in the S. cerevisiae ortholog. As a negative regulator of the signal transduction pathway MEN, overexpression of AMN1 slows the growth of wild type cells. The function of the vertebrate members of this family has not been determined experimentally, they have fewer LRRs that determine the extent of this model. Length = 226
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|197685 smart00367, LRR_CC, Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>gnl|CDD|197685 smart00367, LRR_CC, Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>gnl|CDD|197685 smart00367, LRR_CC, Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>gnl|CDD|197685 smart00367, LRR_CC, Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 479
KOG4341|consensus483 99.96
KOG4341|consensus483 99.96
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.91
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.9
KOG4194|consensus 873 99.86
KOG4194|consensus 873 99.84
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.79
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.77
KOG0444|consensus 1255 99.7
KOG2120|consensus419 99.68
KOG2120|consensus419 99.67
KOG1909|consensus382 99.64
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.61
KOG1947|consensus482 99.59
KOG0618|consensus 1081 99.58
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.57
KOG1947|consensus482 99.57
KOG0444|consensus 1255 99.55
KOG0618|consensus 1081 99.52
KOG1909|consensus382 99.49
KOG3207|consensus 505 99.39
KOG3207|consensus505 99.37
KOG0472|consensus565 99.33
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.12
KOG2982|consensus418 99.02
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.02
KOG3665|consensus 699 99.0
KOG2982|consensus 418 98.97
KOG0472|consensus565 98.9
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.86
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.85
KOG3665|consensus 699 98.84
KOG4237|consensus498 98.73
KOG4237|consensus 498 98.73
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.72
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.6
KOG1259|consensus490 98.55
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.47
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.43
KOG4658|consensus889 98.38
KOG1259|consensus490 98.29
KOG4658|consensus889 98.2
KOG3864|consensus221 98.16
KOG3864|consensus221 98.15
KOG0617|consensus264 97.94
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.8
KOG4308|consensus 478 97.6
KOG1859|consensus 1096 97.51
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.43
KOG4308|consensus478 97.41
KOG1859|consensus 1096 97.36
KOG0617|consensus264 97.26
KOG1644|consensus233 97.22
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.16
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 97.11
KOG2123|consensus388 97.09
KOG2739|consensus260 97.06
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.06
PRK15386 426 type III secretion protein GogB; Provisional 96.93
KOG2739|consensus260 96.87
PLN03150623 hypothetical protein; Provisional 96.84
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 96.81
PLN03150623 hypothetical protein; Provisional 96.65
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 96.62
KOG2123|consensus 388 96.55
PRK15386 426 type III secretion protein GogB; Provisional 96.51
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 96.47
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 96.41
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 96.26
KOG4579|consensus177 96.21
KOG1644|consensus233 96.03
KOG0531|consensus414 95.77
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 95.72
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 95.55
KOG0531|consensus414 95.52
KOG4579|consensus177 95.19
KOG3763|consensus 585 93.71
KOG3763|consensus 585 93.66
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.34
KOG0532|consensus 722 90.51
KOG0532|consensus 722 89.87
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 81.2
>KOG4341|consensus Back     alignment and domain information 
Probab=99.96  E-value=4.1e-30  Score=222.59  Aligned_cols=339  Identities=29%  Similarity=0.589  Sum_probs=237.0

Q ss_pred             CCCcEEEeecCcc-cCcHHHHHHHHh-CCCccEEecCCCCCCChHHHHHHHHhCCccceeeccCccccchhHHHHHHHhc
Q psy5339          91 SQLKELSVSDCTQ-VTDFGLYELAKL-GATLRYLSVAKCDQVSDAGLKVIARRCYKLRYLNARGCEAVSDDAITVLARSC  168 (479)
Q Consensus        91 ~~L~~L~l~~~~~-~~~~~~~~l~~~-~~~L~~L~l~~~~~~~~~~l~~l~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~  168 (479)
                      .+-+++++..... +....+..+.+. ...|+.|.+++|..+.+..+..+...||++++|.+.+|..+++.....+.+.|
T Consensus       110 ~~~q~idL~t~~rDv~g~VV~~~~~Rcgg~lk~LSlrG~r~v~~sslrt~~~~CpnIehL~l~gc~~iTd~s~~sla~~C  189 (483)
T KOG4341|consen  110 SCWQHIDLFTFQRDVDGGVVENMISRCGGFLKELSLRGCRAVGDSSLRTFASNCPNIEHLALYGCKKITDSSLLSLARYC  189 (483)
T ss_pred             ccceeeehhcchhcCCCcceehHhhhhccccccccccccccCCcchhhHHhhhCCchhhhhhhcceeccHHHHHHHHHhc
Confidence            4556666653211 122222333322 35688888888888888888888888888888888888888888888888888


Q ss_pred             CccceEEcCCc-ccCHHHHHHHHHcCCCCcEEecCCCCCcChHHHHHHHhhCCCCcEEEccCcccchhhhHHHHhhhccc
Q psy5339         169 TRLRALDIGKC-DVSDAGLRALAESCPNIKKLSLRQCDLVTDRGVQCIAYYCRGLQQLNIQDCQISVEGYRAVKKYCKRC  247 (479)
Q Consensus       169 ~~L~~L~l~~~-~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~~~  247 (479)
                      ++|+.|.+..| .+++..++.+.+.|++|+.++++.|+.+...++..+..++..++.+...||                 
T Consensus       190 ~~l~~l~L~~c~~iT~~~Lk~la~gC~kL~~lNlSwc~qi~~~gv~~~~rG~~~l~~~~~kGC-----------------  252 (483)
T KOG4341|consen  190 RKLRHLNLHSCSSITDVSLKYLAEGCRKLKYLNLSWCPQISGNGVQALQRGCKELEKLSLKGC-----------------  252 (483)
T ss_pred             chhhhhhhcccchhHHHHHHHHHHhhhhHHHhhhccCchhhcCcchHHhccchhhhhhhhccc-----------------
Confidence            88888888885 477777887888888888888888887777777777766666665555554                 


Q ss_pred             cccccccccCCcccceeEEecCCCCCCChhhHHHHHhcCCCccEEEeccCCccCcchhccccccCCCCcEEeccCCCCCC
Q psy5339         248 CIQISCLTASPTQLLLQFLDLTDCSNVDDQGLSLIVSNCPQLIYLYLRRCVKLTDIGIKYVPSFCSQLKELSVSDCTQVT  327 (479)
Q Consensus       248 ~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~l~~~~~~L~~L~l~~~~~~~  327 (479)
                                              .....+.+..+...++.+.++++..|+.+++.++..+...+..|+.|+.++|..++
T Consensus       253 ------------------------~e~~le~l~~~~~~~~~i~~lnl~~c~~lTD~~~~~i~~~c~~lq~l~~s~~t~~~  308 (483)
T KOG4341|consen  253 ------------------------LELELEALLKAAAYCLEILKLNLQHCNQLTDEDLWLIACGCHALQVLCYSSCTDIT  308 (483)
T ss_pred             ------------------------ccccHHHHHHHhccChHhhccchhhhccccchHHHHHhhhhhHhhhhcccCCCCCc
Confidence                                    44555555555556666666666666677776666666666677777777776677


Q ss_pred             cHHHHHHHHcCCCccEEeccccCCCChhHHHHHHHhCCCccEEeccCCCCccHHHHHHHHHhCCCCcEEEecCCC-CCHH
Q psy5339         328 DFGLYELAKLGATLRYLSVAKCDQVSDAGLKVIARRCYKLRYLNARGCEAVSDDAITVLARSCTRLRALDIGKCD-VSDA  406 (479)
Q Consensus       328 ~~~~~~l~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~~L~l~~~~-i~~~  406 (479)
                      +..+..+...+++|+.+.++.|.++++.++..+..+++.|+.+++.+|..+++.++..++.+||.|+++.+++|. ++|+
T Consensus       309 d~~l~aLg~~~~~L~~l~l~~c~~fsd~~ft~l~rn~~~Le~l~~e~~~~~~d~tL~sls~~C~~lr~lslshce~itD~  388 (483)
T KOG4341|consen  309 DEVLWALGQHCHNLQVLELSGCQQFSDRGFTMLGRNCPHLERLDLEECGLITDGTLASLSRNCPRLRVLSLSHCELITDE  388 (483)
T ss_pred             hHHHHHHhcCCCceEEEeccccchhhhhhhhhhhcCChhhhhhcccccceehhhhHhhhccCCchhccCChhhhhhhhhh
Confidence            766666666667777777777777777777777777777777777777766666666676677777777777776 6666


Q ss_pred             HHHHHHh---hCCCCcEEeccCCcccchhhHHHHHHcCccccEEEecccc-cChHHHHHHHHhhhhcce
Q psy5339         407 GLRALAE---SCPNIKKLSLRQCDLVTDRGVQCIAYYCRGLQQLNIQDCQ-ISVEGYRAVKKYCKRCII  471 (479)
Q Consensus       407 ~~~~l~~---~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~L~~L~l~~~~-i~~~~~~~l~~~~~~~~i  471 (479)
                      ++..+..   ....|+.+++.+|+.+++..++.+ ..|+.|+.+++.+|+ ++.+++++++..+|+..|
T Consensus       389 gi~~l~~~~c~~~~l~~lEL~n~p~i~d~~Le~l-~~c~~Leri~l~~~q~vtk~~i~~~~~~lp~i~v  456 (483)
T KOG4341|consen  389 GIRHLSSSSCSLEGLEVLELDNCPLITDATLEHL-SICRNLERIELIDCQDVTKEAISRFATHLPNIKV  456 (483)
T ss_pred             hhhhhhhccccccccceeeecCCCCchHHHHHHH-hhCcccceeeeechhhhhhhhhHHHHhhCcccee
Confidence            6665553   345577777777776666555544 456777777777775 777777777777776665

>KOG4341|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG3763|consensus Back     alignment and domain information
>KOG3763|consensus Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query479
2p1m_B594 Tir1-ask1 Complex Structure Length = 594 3e-11
2p1m_B 594 Tir1-ask1 Complex Structure Length = 594 7e-04
3ogk_B592 Structure Of Coi1-Ask1 In Complex With Coronatine A 7e-08
1fqv_A336 Insights Into Scf Ubiquitin Ligases From The Struct 5e-05
1fs2_A272 Insights Into Scf Ubiquitin Ligases From The Struct 5e-05
>pdb|2P1M|B Chain B, Tir1-ask1 Complex Structure Length = 594 Back     alignment and structure 
Iteration: 1

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 90/420 (21%), Positives = 157/420 (37%), Gaps = 85/420 (20%)
Query: 104 VTDFGLYELAKLGATLRYLSVAKCDQVSDAGLKVIARRCYKLRYLNARGCEA--VSDDAI 161
           VTD  L  +AK     + L ++ C+  S  GL  IA  C  L+ L+ R  +   VS   +
Sbjct: 117 VTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKELDLRESDVDDVSGHWL 176
Query: 162 TVLARSCTRLRALDIG--KCDVSDAGLRALAESCPNIKKLSLRQCDLVTDRGVQCIAYYC 219
           +    + T L +L+I     +VS + L  L   CPN+K L L +        ++ +A   
Sbjct: 177 SHFPDTYTSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNRA-----VPLEKLATLL 231
Query: 220 RGLQQLNIQDCQISVEGYRAVKK--------YCKRCCIQISCLTA-SPXXXXXXXXXXXX 270
           +   QL     ++   GY A  +             C ++ CL+                
Sbjct: 232 QRAPQLE----ELGTGGYTAEVRPDVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSV 287
Query: 271 CSNVDDQGLSL----------IVSNCPQLIYLYLRRCVKLTDIGIKYVPSFCSQLKELSV 320
           CS +    LS           ++  CP+L  L++   ++  D G++ + S C  L+EL V
Sbjct: 288 CSRLTTLNLSYATVQSYDLVKLLCQCPKLQRLWVLDYIE--DAGLEVLASTCKDLRELRV 345
Query: 321 --------SDCTQVTDFGLYELA----KLGATLRYLSVAKCDQVSDAGLKVIARRCYKLR 368
                        +T+ GL  ++    KL + L +     C Q+++A L  IAR    + 
Sbjct: 346 FPSEPFVMEPNVALTEQGLVSVSMGCPKLESVLYF-----CRQMTNAALITIARNRPNMT 400
Query: 369 -------------YLNAR----GCEAV----------------SDDAITVLARSCTRLRA 395
                        YL       G  A+                +D     +     ++  
Sbjct: 401 RFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLSGLLTDKVFEYIGTYAKKMEM 460
Query: 396 LDIGKCDVSDAGLRALAESCPNIKKLSLRQCDLVTDRGVQCIAYYCRGLQQLNIQDCQIS 455
           L +     SD G+  +   C +++KL +R C    D+ +   A     ++ L +  C +S
Sbjct: 461 LSVAFAGDSDLGMHHVLSGCDSLRKLEIRDCPF-GDKALLANASKLETMRSLWMSSCSVS 519
>pdb|2P1M|B Chain B, Tir1-ask1 Complex Structure Length = 594 Back     alignment and structure
>pdb|3OGK|B Chain B, Structure Of Coi1-Ask1 In Complex With Coronatine And An Incomplete Jaz1 Degron Length = 592 Back     alignment and structure
>pdb|1FQV|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure Of The Skp1-Skp2 Complex Length = 336 Back     alignment and structure
>pdb|1FS2|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure Of The Skp1-Skp2 Complex Length = 272 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query479
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-81
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-67
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 7e-55
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-13
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-74
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-64
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-55
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-44
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 9e-40
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-36
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 9e-34
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-36
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-35
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-34
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-25
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-17
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-10
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-10
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-22
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-19
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-15
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-18
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 9e-17
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-17
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-17
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-14
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-14
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-13
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 3e-13
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-12
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-11
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-11
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-11
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-10
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-08
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 2e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-06
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 6e-08
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 6e-08
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 2e-05
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 4e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 7e-04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 7e-04
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
 Score =  261 bits (669), Expect = 5e-81
 Identities = 88/463 (19%), Positives = 165/463 (35%), Gaps = 52/463 (11%)

Query: 41  LQFLDLTDCSNVDDQGLSLIVSNCPQLIYLYLRRCVKLTDIGIKYVPSFCSQLKELSVSD 100
           L+ + L     V D  L LI  +      L L  C   +  G+  + + C  LKEL + +
Sbjct: 107 LEEIRLKRMV-VTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKELDLRE 165

Query: 101 C--TQVTDFGLYELAKLGATLRYLSVAKC-DQVSDAGLKVIARRCYKLRYLNARGCEAVS 157
                V+   L        +L  L+++    +VS + L+ +  RC  L+ L       V 
Sbjct: 166 SDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNRA--VP 223

Query: 158 DDAITVLARSCTRLRALDIGKC-----DVSDAGLRALAESCPNIKKLSLRQCDLVTDRGV 212
            + +  L +   +L  L  G           +GL      C  ++ LS           +
Sbjct: 224 LEKLATLLQRAPQLEELGTGGYTAEVRPDVYSGLSVALSGCKELRCLSG--FWDAVPAYL 281

Query: 213 QCIAYYCRGLQQLNIQDCQISVEGYRAVKKYCKRCCIQISCLTASPTQLLLQFLDLTDCS 272
             +   C  L  LN+    +       +   C +                LQ L +    
Sbjct: 282 PAVYSVCSRLTTLNLSYATVQSYDLVKLLCQCPK----------------LQRLWV--LD 323

Query: 273 NVDDQGLSLIVSNCPQLIYLYLRR--------CVKLTDIGIKYVPSFCSQLKELSVSDCT 324
            ++D GL ++ S C  L  L +           V LT+ G+  V   C +L+ + +  C 
Sbjct: 324 YIEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESV-LYFCR 382

Query: 325 QVTDFGLYELAKLGATLRYLSVAKCD---------QVSDAGLKVIARRCYKLRYLNARGC 375
           Q+T+  L  +A+    +    +   +         +  D G   I   C  LR L+  G 
Sbjct: 383 QMTNAALITIARNRPNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLSGL 442

Query: 376 EAVSDDAITVLARSCTRLRALDIGKCDVSDAGLRALAESCPNIKKLSLRQCDLVTDRGVQ 435
             ++D     +     ++  L +     SD G+  +   C +++KL +R C    D+ + 
Sbjct: 443 --LTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCDSLRKLEIRDCPF-GDKALL 499

Query: 436 CIAYYCRGLQQLNIQDCQISVEGYRAVKKYCKRCIIEHTNPAF 478
             A     ++ L +  C +S    + + +   +  +E  +   
Sbjct: 500 ANASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDERG 542
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query479
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 100.0
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 100.0
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 100.0
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.93
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.93
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.93
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.92
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.92
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.92
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.91
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.91
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.91
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.91
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.9
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.9
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.9
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.89
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.89
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.88
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.87
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.87
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.87
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.87
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.87
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.87
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.87
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.85
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.84
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.83
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.82
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.82
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.8
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.79
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.79
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.79
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.78
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.76
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.75
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.73
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.73
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.72
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.71
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.65
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.64
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.63
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.62
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.62
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.61
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.6
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.6
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.58
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.58
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.55
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.55
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.54
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.54
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.54
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.53
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.52
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.51
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.49
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.47
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.46
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.46
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.45
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.45
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.45
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.44
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.44
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.44
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.44
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.44
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.43
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.41
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.41
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.39
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.34
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 99.28
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.27
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.26
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.26
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.25
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.25
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.24
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.24
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.24
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.17
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.14
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.05
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 99.04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.03
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.0
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.0
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.98
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.97
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.96
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.96
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.92
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.87
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.85
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.81
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 98.8
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.76
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.7
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.69
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.67
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.67
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.66
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.64
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.63
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.63
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.62
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.62
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.58
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.56
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.54
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.53
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.51
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.49
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.48
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.36
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.26
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.21
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.15
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.12
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.06
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 97.94
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.9
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.72
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.7
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.68
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.55
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.54
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.51
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.48
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.28
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 97.07
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.99
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 96.91
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.52
4gt6_A394 Cell surface protein; leucine rich repeats, putati 86.58
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 83.45
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 82.02
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
Probab=100.00  E-value=3.8e-37  Score=306.77  Aligned_cols=410  Identities=21%  Similarity=0.336  Sum_probs=312.6

Q ss_pred             cccccceeccCCCCCCchhhHHHHHhcCCcccEEecccccccchhhHhhhhhcCCCCcEEEeecCcccCcHH---HHHHH
Q psy5339          37 TQLLLQFLDLTDCSNVDDQGLSLIVSNCPQLIYLYLRRCVKLTDIGIKYVPSFCSQLKELSVSDCTQVTDFG---LYELA  113 (479)
Q Consensus        37 ~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~---~~~l~  113 (479)
                      .+++|++|++++| .+.+..+..+...+++|++|++++|..+++.++..+...+++|++|++++|. +++.+   +..+.
T Consensus       103 ~~~~L~~L~L~~~-~~~~~~~~~l~~~~~~L~~L~L~~~~~~~~~~l~~~~~~~~~L~~L~L~~~~-i~~~~~~~l~~~~  180 (594)
T 2p1m_B          103 SYTWLEEIRLKRM-VVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKELDLRESD-VDDVSGHWLSHFP  180 (594)
T ss_dssp             HCTTCCEEEEESC-BCCHHHHHHHHHHCTTCCEEEEESCEEEEHHHHHHHHHHCTTCCEEECTTCE-EECCCGGGGGGSC
T ss_pred             hCCCCCeEEeeCc-EEcHHHHHHHHHhCCCCcEEeCCCcCCCCHHHHHHHHHhCCCCCEEeCcCCc-cCCcchHHHHHHh
Confidence            4567888888876 4666666666556778888888877667766677777667788888887753 43322   33334


Q ss_pred             HhCCCccEEecCCCC-CCChHHHHHHHHhCCccceeeccCccccchhHHHHHHHhcCccceEEcCCcc--cCHHHH---H
Q psy5339         114 KLGATLRYLSVAKCD-QVSDAGLKVIARRCYKLRYLNARGCEAVSDDAITVLARSCTRLRALDIGKCD--VSDAGL---R  187 (479)
Q Consensus       114 ~~~~~L~~L~l~~~~-~~~~~~l~~l~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~--~~~~~~---~  187 (479)
                      ..+++|++|+++++. .++...+..+...+++|++|++.++...  ..+..+...+++|++|++..+.  +....+   .
T Consensus       181 ~~~~~L~~L~l~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~~~--~~l~~~~~~~~~L~~L~l~~~~~~~~~~~~~~l~  258 (594)
T 2p1m_B          181 DTYTSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNRAVPL--EKLATLLQRAPQLEELGTGGYTAEVRPDVYSGLS  258 (594)
T ss_dssp             TTCCCCCEEECTTCCSCCCHHHHHHHHHHCTTCCEEECCTTSCH--HHHHHHHHHCTTCSEEECSBCCCCCCHHHHHHHH
T ss_pred             hcCCcCcEEEecccCCcCCHHHHHHHHHhCCCCcEEecCCCCcH--HHHHHHHhcCCcceEcccccccCccchhhHHHHH
Confidence            456778888887764 4666667777777788888888776432  2255566667788888776553  222222   2


Q ss_pred             HHHHcCCCCcEE-ecCCCCCcChHHHHHHHhhCCCCcEEEccCcccchhhhHHHHhhhccccccccccccCCcccceeEE
Q psy5339         188 ALAESCPNIKKL-SLRQCDLVTDRGVQCIAYYCRGLQQLNIQDCQISVEGYRAVKKYCKRCCIQISCLTASPTQLLLQFL  266 (479)
Q Consensus       188 ~l~~~~~~L~~L-~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~L~~L  266 (479)
                      .....+++|+.+ .+.   ......+..+...+++|++|++++|.+.+.++..+..                ..++|++|
T Consensus       259 ~~l~~~~~L~~Ls~~~---~~~~~~l~~~~~~~~~L~~L~L~~~~l~~~~l~~~~~----------------~~~~L~~L  319 (594)
T 2p1m_B          259 VALSGCKELRCLSGFW---DAVPAYLPAVYSVCSRLTTLNLSYATVQSYDLVKLLC----------------QCPKLQRL  319 (594)
T ss_dssp             HHHHTCTTCCEEECCB---TCCGGGGGGGHHHHTTCCEEECTTCCCCHHHHHHHHT----------------TCTTCCEE
T ss_pred             HHHhcCCCcccccCCc---ccchhhHHHHHHhhCCCCEEEccCCCCCHHHHHHHHh----------------cCCCcCEE
Confidence            223557777777 333   2334555556667899999999999987766555432                23469999


Q ss_pred             ecCCCCCCChhhHHHHHhcCCCccEEEe--------ccCCccCcchhccccccCCCCcEEeccCCCCCCcHHHHHHHHcC
Q psy5339         267 DLTDCSNVDDQGLSLIVSNCPQLIYLYL--------RRCVKLTDIGIKYVPSFCSQLKELSVSDCTQVTDFGLYELAKLG  338 (479)
Q Consensus       267 ~l~~~~~~~~~~~~~~~~~~~~L~~L~l--------~~~~~l~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~  338 (479)
                      ++.++  +.+.++..+...+++|+.|++        .+++.+++.++..+...+++|++|.+.. +.+++.++..+...+
T Consensus       320 ~l~~~--~~~~~l~~l~~~~~~L~~L~L~~~~~~g~~~~~~l~~~~l~~l~~~~~~L~~L~~~~-~~l~~~~~~~l~~~~  396 (594)
T 2p1m_B          320 WVLDY--IEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESVLYFC-RQMTNAALITIARNR  396 (594)
T ss_dssp             EEEGG--GHHHHHHHHHHHCTTCCEEEEECSCTTCSSCSSCCCHHHHHHHHHHCTTCCEEEEEE-SCCCHHHHHHHHHHC
T ss_pred             eCcCc--cCHHHHHHHHHhCCCCCEEEEecCcccccccCCCCCHHHHHHHHHhchhHHHHHHhc-CCcCHHHHHHHHhhC
Confidence            99985  667777777778999999999        3456788888877777789999997655 689999888888888


Q ss_pred             CCccEEecc-----ccCCCC----hhHHHHHHHhCCCccEEeccCCCCccHHHHHHHHHhCCCCcEEEecCCCCCHHHHH
Q psy5339         339 ATLRYLSVA-----KCDQVS----DAGLKVIARRCYKLRYLNARGCEAVSDDAITVLARSCTRLRALDIGKCDVSDAGLR  409 (479)
Q Consensus       339 ~~L~~L~l~-----~~~~l~----~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~~L~l~~~~i~~~~~~  409 (479)
                      ++|++|+++     +|+.++    +.++..+...+++|++|++++  .+++.++..+...+++|+.|++++|.+++.++.
T Consensus       397 ~~L~~L~L~~~~~~~~~~l~~~~~~~~~~~l~~~~~~L~~L~L~~--~l~~~~~~~l~~~~~~L~~L~L~~~~i~~~~~~  474 (594)
T 2p1m_B          397 PNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLSG--LLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMH  474 (594)
T ss_dssp             TTCCEEEEEESSTTCCCTTTCCCTHHHHHHHHHHCTTCCEEECCS--SCCHHHHHHHHHHCTTCCEEEEESCCSSHHHHH
T ss_pred             CCcceeEeecccCCCcccccCCchhhHHHHHHhhCCCccEEeecC--cccHHHHHHHHHhchhccEeeccCCCCcHHHHH
Confidence            999999999     677888    778888888999999999977  689989988888899999999999999999999


Q ss_pred             HHHhhCCCCcEEeccCCcccchhhHHHHHHcCccccEEEecccccChHHHHHHHHhhhhcceeccC
Q psy5339         410 ALAESCPNIKKLSLRQCDLVTDRGVQCIAYYCRGLQQLNIQDCQISVEGYRAVKKYCKRCIIEHTN  475 (479)
Q Consensus       410 ~l~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~L~~L~l~~~~i~~~~~~~l~~~~~~~~i~~~~  475 (479)
                      .+...+++|++|++++|+ +++.++..+...+++|+.|++++|++++++++.+...+|++++.++.
T Consensus       475 ~l~~~~~~L~~L~L~~n~-~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~~lp~l~i~~~~  539 (594)
T 2p1m_B          475 HVLSGCDSLRKLEIRDCP-FGDKALLANASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVID  539 (594)
T ss_dssp             HHHHHCTTCCEEEEESCS-CCHHHHHHTGGGGGGSSEEEEESSCCBHHHHHHHHHHCTTEEEEEEC
T ss_pred             HHHhcCCCcCEEECcCCC-CcHHHHHHHHHhCCCCCEEeeeCCCCCHHHHHHHHHhCCCCEEEEec
Confidence            998889999999999995 58888877777889999999999999999999998889998876654
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 479
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-12
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-06
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-04
d1io0a_166 c.10.1.1 (A:) Tropomodulin C-terminal domain {Chic 0.002
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 66.3 bits (160), Expect = 1e-12
 Identities = 40/235 (17%), Positives = 78/235 (33%), Gaps = 17/235 (7%)

Query: 146 RYLNARGCEAVSDDAITVLARSCTRLRALDIGKCDVSDAGLRALAESCPNIKKLSLRQCD 205
           + + A  C     D       S  R++ +D+    +  + L  +   C  ++ LSL    
Sbjct: 23  QGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLR 82

Query: 206 LVTDRGVQCIAYYCRGLQQLNIQDCQ-ISVEGYRAVKKYCKRCCI-----------QISC 253
           L +D  V  +A     L +LN+  C   S    + +   C R              +   
Sbjct: 83  L-SDPIVNTLA-KNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQ 140

Query: 254 LTASPTQLLLQFLDLTDCSNVDDQGLSLIVSNCPQLIYLYLRRCVKLTDIGIKYVPSFCS 313
           +  +     +  L+L+       +     +      +         +            +
Sbjct: 141 VAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLN 200

Query: 314 QLKELSVSDCTQVTDFGLYELAKLGATLRYLSVAKCDQVSDAGLKVIARRCYKLR 368
            L+ LS+S C  +    L EL ++  TL+ L V     V D  L+++      L+
Sbjct: 201 YLQHLSLSRCYDIIPETLLELGEI-PTLKTLQVFGI--VPDGTLQLLKEALPHLQ 252
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 166 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query479
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.93
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.93
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.92
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.9
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.78
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.74
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.63
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.62
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.31
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.25
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.24
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.19
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.09
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.08
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.05
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.03
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.03
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.02
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.02
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.99
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.98
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.96
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.94
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.9
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.89
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.89
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.88
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.87
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.84
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.82
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.81
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.69
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.56
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.52
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.48
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.36
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.36
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.96
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.7
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.69
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.66
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.23
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: 28-residue LRR
domain: Ribonuclease inhibitor
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.93  E-value=3.2e-23  Score=197.38  Aligned_cols=401  Identities=22%  Similarity=0.288  Sum_probs=215.4

Q ss_pred             ccceeccCCCCCCchhhHHHHHhcCCcccEEecccccccchhhHhhhh---hcCCCCcEEEeecCcccCcHHHHHHHHhC
Q psy5339          40 LLQFLDLTDCSNVDDQGLSLIVSNCPQLIYLYLRRCVKLTDIGIKYVP---SFCSQLKELSVSDCTQVTDFGLYELAKLG  116 (479)
Q Consensus        40 ~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~---~~~~~L~~L~l~~~~~~~~~~~~~l~~~~  116 (479)
                      +|++||++++ .+.+..+..++..++++++|+|++| ++++.++..+.   ..+++|++|++++ +.+++.++..+...+
T Consensus         3 ~l~~ld~~~~-~i~~~~~~~l~~~l~~l~~L~L~~~-~i~~~~~~~l~~~L~~~~~L~~LdLs~-N~i~~~~~~~l~~~l   79 (460)
T d1z7xw1           3 DIQSLDIQCE-ELSDARWAELLPLLQQCQVVRLDDC-GLTEARCKDISSALRVNPALAELNLRS-NELGDVGVHCVLQGL   79 (460)
T ss_dssp             EEEEEEEESC-CCCHHHHHHHHHHHTTCSEEEEESS-CCCHHHHHHHHHHHHTCTTCCEEECTT-CCCHHHHHHHHHHTT
T ss_pred             CCCEEEeeCC-cCChHHHHHHHHhCCCCCEEEeCCC-CCCHHHHHHHHHHHhcCCCCCEEECcC-CcCChHHHHHHHHHH
Confidence            4555566554 5555555555555556666666654 45554443333   3445566666655 345555555544332


Q ss_pred             ----CCccEEecCCCCCCChHHHHHHH---HhCCccceeeccCccccchhHHHHHHHhc----CccceEEcCCcccCHH-
Q psy5339         117 ----ATLRYLSVAKCDQVSDAGLKVIA---RRCYKLRYLNARGCEAVSDDAITVLARSC----TRLRALDIGKCDVSDA-  184 (479)
Q Consensus       117 ----~~L~~L~l~~~~~~~~~~l~~l~---~~~~~L~~L~l~~~~~~~~~~~~~~~~~~----~~L~~L~l~~~~~~~~-  184 (479)
                          .+|++|+++++ .+++.+...+.   ..+++|++|+++++. +.+.++..+....    ............+... 
T Consensus        80 ~~~~~~L~~L~L~~n-~it~~~~~~l~~~l~~~~~L~~L~L~~N~-i~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~  157 (460)
T d1z7xw1          80 QTPSCKIQKLSLQNC-CLTGAGCGVLSSTLRTLPTLQELHLSDNL-LGDAGLQLLCEGLLDPQCRLEKLQLEYCSLSAAS  157 (460)
T ss_dssp             CSTTCCCCEEECTTS-CCBGGGHHHHHHHTTSCTTCCEEECCSSB-CHHHHHHHHHHHHTSTTCCCCEEECTTSCCBGGG
T ss_pred             hcCCCCCCEEECCCC-Cccccccccccchhhcccccccccccccc-chhhhhhhhhhcccccccccccccccccccchhh
Confidence                34566666554 34444433332   234555666655542 3333333322211    1122223322222111 


Q ss_pred             --HHHHHHHcCCCCcEEecCCCCCcChHHHHHH----HhhCCCCcEEEccCcccchhhhHHHHhhhccccccccccccCC
Q psy5339         185 --GLRALAESCPNIKKLSLRQCDLVTDRGVQCI----AYYCRGLQQLNIQDCQISVEGYRAVKKYCKRCCIQISCLTASP  258 (479)
Q Consensus       185 --~~~~l~~~~~~L~~L~l~~~~~~~~~~~~~~----~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~  258 (479)
                        .........+.++.+.++++ .....+....    .........+.+..+.+...+...+......            
T Consensus       158 ~~~~~~~l~~~~~~~~~~ls~~-~~~~~~~~~~~~~l~~~~~~~~~l~~~~~~~~~~~~~~~~~~l~~------------  224 (460)
T d1z7xw1         158 CEPLASVLRAKPDFKELTVSNN-DINEAGVRVLCQGLKDSPCQLEALKLESCGVTSDNCRDLCGIVAS------------  224 (460)
T ss_dssp             HHHHHHHHHHCTTCCEEECCSS-BCHHHHHHHHHHHHHHSCCCCCEEECTTSCCBTTHHHHHHHHHHH------------
T ss_pred             hccccccccccccccccccccc-ccccccccccccccccccccccccccccccccchhhhcccccccc------------
Confidence              11122233455555555544 2222222111    1122344555555555544444433332211            


Q ss_pred             cccceeEEecCCCCCCChhh----HHHHHhcCCCccEEEeccCCccCcchhccc---cccCCCCcEEeccCCCCCCcHHH
Q psy5339         259 TQLLLQFLDLTDCSNVDDQG----LSLIVSNCPQLIYLYLRRCVKLTDIGIKYV---PSFCSQLKELSVSDCTQVTDFGL  331 (479)
Q Consensus       259 ~~~~L~~L~l~~~~~~~~~~----~~~~~~~~~~L~~L~l~~~~~l~~~~~~~l---~~~~~~L~~L~l~~~~~~~~~~~  331 (479)
                       .+.++.+.+.++ ...+..    ........+.++.+++++ +.+........   ....+.++.++++++ .+++.++
T Consensus       225 -~~~~~~l~~~~n-~~~~~~~~~~~~~~~~~~~~l~~l~l~~-n~i~~~~~~~~~~~l~~~~~l~~l~l~~n-~i~~~~~  300 (460)
T d1z7xw1         225 -KASLRELALGSN-KLGDVGMAELCPGLLHPSSRLRTLWIWE-CGITAKGCGDLCRVLRAKESLKELSLAGN-ELGDEGA  300 (460)
T ss_dssp             -CTTCCEEECCSS-BCHHHHHHHHHHHHTSTTCCCCEEECTT-SCCCHHHHHHHHHHHHHCTTCCEEECTTC-CCHHHHH
T ss_pred             -cccccccchhhc-cccccccchhhccccccccccccccccc-ccccccccccccccccccccccccccccc-ccccccc
Confidence             112555555553 222221    122223455677777776 34444332222   123367778888773 6776666


Q ss_pred             HHHHH----cCCCccEEeccccCCCChhHHHHH---HHhCCCccEEeccCCCCccHHHHHHHHH----hCCCCcEEEecC
Q psy5339         332 YELAK----LGATLRYLSVAKCDQVSDAGLKVI---ARRCYKLRYLNARGCEAVSDDAITVLAR----SCTRLRALDIGK  400 (479)
Q Consensus       332 ~~l~~----~~~~L~~L~l~~~~~l~~~~~~~~---~~~~~~L~~L~l~~~~~~~~~~~~~l~~----~~~~L~~L~l~~  400 (479)
                      ..+..    ....|+.+.++++ .+++.++..+   ...+++|++|+++++ .+++.++..++.    ..+.|++|++++
T Consensus       301 ~~l~~~l~~~~~~L~~l~l~~~-~l~~~~~~~l~~~~~~~~~L~~L~Ls~N-~i~~~g~~~l~~~l~~~~~~L~~L~Ls~  378 (460)
T d1z7xw1         301 RLLCETLLEPGCQLESLWVKSC-SFTAACCSHFSSVLAQNRFLLELQISNN-RLEDAGVRELCQGLGQPGSVLRVLWLAD  378 (460)
T ss_dssp             HHHHHHHTSTTCCCCEEECTTS-CCBGGGHHHHHHHHHHCSSCCEEECCSS-BCHHHHHHHHHHHHTSTTCCCCEEECTT
T ss_pred             chhhcccccccccccccccccc-chhhhhhhhcccccccccchhhhheeee-cccCcccchhhhhhhcccCCCCEEECCC
Confidence            55543    2347888888874 5666554443   345678999999886 577776666543    356799999999


Q ss_pred             CCCCHHHHHHHHh---hCCCCcEEeccCCcccchhhHHHHHHcC----ccccEEEecccccChHHHHHHHHh
Q psy5339         401 CDVSDAGLRALAE---SCPNIKKLSLRQCDLVTDRGVQCIAYYC----RGLQQLNIQDCQISVEGYRAVKKY  465 (479)
Q Consensus       401 ~~i~~~~~~~l~~---~~~~L~~L~l~~~~~l~~~~~~~~~~~~----~~L~~L~l~~~~i~~~~~~~l~~~  465 (479)
                      |+++++++.++++   .+++|++|++++| .+++.++..+...+    ..|+.|++.++.+.++..+.+...
T Consensus       379 n~i~~~~~~~l~~~l~~~~~L~~L~Ls~N-~i~~~g~~~l~~~l~~~~~~L~~l~l~~~~~~~~~~~~l~~l  449 (460)
T d1z7xw1         379 CDVSDSSCSSLAATLLANHSLRELDLSNN-CLGDAGILQLVESVRQPGCLLEQLVLYDIYWSEEMEDRLQAL  449 (460)
T ss_dssp             SCCCHHHHHHHHHHHHHCCCCCEEECCSS-SCCHHHHHHHHHHHTSTTCCCCEEECTTCCCCHHHHHHHHHH
T ss_pred             CCCChHHHHHHHHHHhcCCCCCEEECCCC-cCCHHHHHHHHHHHHhCCCccCEEECCCCCCCHHHHHHHHHH
Confidence            9999888777654   4788999999998 68888777665432    369999999999887777666443
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure