Diaphorina citri psyllid: psy534


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-----
MMNSFAVKSIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFLNRSPNSHKNGTWFHLDVHGVFNDGTELRISNIRSQDIGDYTCLATHVLYPDLLVVLGSFHIHTGT
cccHHHHHEEEEEECcccccccccCEEEEEccccccccccccccEEEEEccccccccEEEEEccCEEEcccEEEEEEEEccccccccccccEEEEEEEccccccccccEEEEECcccEEEEEEEEEcccccEEEEEccEEEEccc
****FAVKSIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKG**********FGMASLNLTKIRESDQGWYECKVVFLNRSPNSHKNGTWFHLDVHGVFNDGTELRISNIRSQDIGDYTCLATHVLYPDLLVVLGSFHIH***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMNSFAVKSIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFLNRSPNSHKNGTWFHLDVHGVFNDGTELRISNIRSQDIGDYTCLATHVLYPDLLVVLGSFHIHTGT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0046331 [BP]lateral inhibitionprobableGO:0032502, GO:0044700, GO:0045165, GO:0048869, GO:0030154, GO:0045168, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0009987, GO:0044699
GO:0016199 [BP]axon midline choice point recognitionprobableGO:0008037, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007411, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0008038, GO:0044767, GO:0044763, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0032990, GO:0048858, GO:0040011, GO:0048699, GO:0009605, GO:0044707, GO:0050896, GO:0048856, GO:0007399, GO:0016198, GO:0032502, GO:0048812, GO:0008150
GO:0070593 [BP]dendrite self-avoidanceprobableGO:0048666, GO:0008037, GO:0048699, GO:0032501, GO:0030182, GO:0044707, GO:0048869, GO:0030154, GO:0048468, GO:0007399, GO:0008038, GO:0044767, GO:0044763, GO:0048731, GO:0007275, GO:0008150, GO:0009987, GO:0032502, GO:0022008, GO:0044699, GO:0048856
GO:0007629 [BP]flight behaviorprobableGO:0007626, GO:0032501, GO:0044707, GO:0030534, GO:0044708, GO:0050896, GO:0007610, GO:0008150, GO:0008344, GO:0044699
GO:0048814 [BP]regulation of dendrite morphogenesisprobableGO:0022604, GO:0044707, GO:0010975, GO:0022603, GO:0030154, GO:0051128, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0031344, GO:0045664, GO:0010769, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0007399, GO:0050773, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0007275, GO:0048731
GO:0007414 [BP]axonal defasciculationprobableGO:0008037, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0008038, GO:0044767, GO:0044763, GO:0007409, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0044707, GO:0048856, GO:0007399, GO:0032502, GO:0048812, GO:0008150
GO:0008039 [BP]synaptic target recognitionprobableGO:0048666, GO:0008037, GO:0048699, GO:0032501, GO:0030182, GO:0044707, GO:0048869, GO:0030154, GO:0048468, GO:0007399, GO:0008038, GO:0044767, GO:0044763, GO:0048731, GO:0007275, GO:0008150, GO:0009987, GO:0032502, GO:0022008, GO:0044699, GO:0048856
GO:0030537 [BP]larval behaviorprobableGO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0007610, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3B43, chain A
Confidence level:very confident
Coverage over the Query: 9-129
View the alignment between query and template
View the model in PyMOL
Template: 3SBW, chain C
Confidence level:confident
Coverage over the Query: 8-137
View the alignment between query and template
View the model in PyMOL