Diaphorina citri psyllid: psy5351


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60-----
MVEVWFQNRRTKWRKKHAAEMATAKRKQDQVEESEEEEEDDYRHSDNAAKRLRRELAAHCGVQNM
cEEEHHcHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHccccc
MVEVWF*NRRT******************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVEVWFQNRRTKWRKKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLAAHCGVQNM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Homeobox protein Nkx-6.1 Transcription factor which binds to specific A/T-rich DNA sequences in the promoter regions of a number of genes. Involved in transcriptional regulation in islet beta cells. Binds to the insulin promoter and is involved in regulation of the insulin gene. Together with NKX2-2 and IRX3 acts to restrict the generation of motor neurons to the appropriate region of the neural tube. Belongs to the class II proteins of neuronal progenitor factors, which are induced by SHH signals.confidentP78426
Homeobox protein Nkx-6.1 Transcription factor which binds to specific A/T-rich DNA sequences in the promoter regions of a number of genes. Involved in transcriptional regulation in islet beta cells. Binds to the insulin promoter and is involved in regulation of the insulin gene. Together with NKX2-2 and IRX3 acts to restrict the generation of motor neurons to the appropriate region of the neural tube. Belongs to the class II proteins of neuronal progenitor factors, which are induced by SHH signals.confidentQ99MA9
Homeobox protein Nkx-6.1 Transcription factor which binds to specific A/T-rich DNA sequences in the promoter regions of a number of genes. Involved in transcriptional regulation in islet beta cells. Binds to the insulin promoter and is involved in regulation of the insulin gene. Together with NKX2-2 and IRX3 acts to restrict the generation of motor neurons to the appropriate region of the neural tube. Belongs to the class II proteins of neuronal progenitor factors, which are induced by SHH signals.confidentO35762

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0032024 [BP]positive regulation of insulin secretionprobableGO:0090087, GO:0051046, GO:0051047, GO:0051049, GO:0023051, GO:0010646, GO:0050789, GO:0060341, GO:0065007, GO:0048518, GO:0051050, GO:0050796, GO:0050794, GO:0090276, GO:0046883, GO:0008150, GO:0046887, GO:0032879, GO:0002791, GO:0002793, GO:0090277, GO:0048522
GO:0022010 [BP]central nervous system myelinationprobableGO:0042391, GO:0019226, GO:0021782, GO:0050801, GO:0030154, GO:0048468, GO:0042592, GO:0023052, GO:0010001, GO:0001508, GO:0007272, GO:0007275, GO:0044699, GO:0007417, GO:0042552, GO:0035637, GO:0048869, GO:0008150, GO:0065007, GO:0050877, GO:0019725, GO:0065008, GO:0032502, GO:0032501, GO:0032291, GO:0019228, GO:0009987, GO:0048709, GO:0042063, GO:0006873, GO:0044767, GO:0044763, GO:0008366, GO:0014003, GO:0007154, GO:0022008, GO:0003008, GO:0044700, GO:0044707, GO:0007399, GO:0048856, GO:0048878, GO:0055082, GO:0048731
GO:0051594 [BP]detection of glucoseprobableGO:0009746, GO:0009732, GO:0009730, GO:0034287, GO:0009743, GO:0034284, GO:0050896, GO:0009749, GO:0008150, GO:1901700, GO:0042221, GO:0009593, GO:0010033, GO:0051606
GO:0003323 [BP]type B pancreatic cell developmentprobableGO:0031018, GO:0031016, GO:0048468, GO:0032501, GO:0007275, GO:0044699, GO:0003309, GO:0048869, GO:0002068, GO:0048513, GO:0030855, GO:0002066, GO:0002067, GO:0002064, GO:0002065, GO:0032502, GO:0030154, GO:0060429, GO:0009888, GO:0044767, GO:0035270, GO:0008150, GO:0035883, GO:0044707, GO:0048856, GO:0044763, GO:0048731, GO:0009987
GO:0006366 [BP]transcription from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0050885 [BP]neuromuscular process controlling balanceprobableGO:0032501, GO:0044707, GO:0050877, GO:0008150, GO:0050905, GO:0044699, GO:0003008
GO:0007224 [BP]smoothened signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0000976 [MF]transcription regulatory region sequence-specific DNA bindingprobableGO:0044212, GO:0043565, GO:0097159, GO:0003677, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0000975, GO:1901363
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0045666 [BP]positive regulation of neuron differentiationprobableGO:0030154, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0007275, GO:0045664, GO:0065007, GO:0048518, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045597, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0051094, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0048731, GO:0048522
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0003705 [MF]RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activityprobableGO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:0045687 [BP]positive regulation of glial cell differentiationprobableGO:0030154, GO:0050789, GO:0045685, GO:0014015, GO:0014013, GO:0048869, GO:0060284, GO:0050769, GO:0008150, GO:0065007, GO:0044699, GO:0010720, GO:0048518, GO:0032502, GO:0032501, GO:0050767, GO:0050793, GO:0009987, GO:0050794, GO:0045597, GO:0045595, GO:0044763, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0051094, GO:0048856, GO:0051960, GO:2000026, GO:0007275, GO:0048731, GO:0048522
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0045686 [BP]negative regulation of glial cell differentiationprobableGO:0030154, GO:0060284, GO:0050789, GO:0045685, GO:0014014, GO:0050767, GO:0014013, GO:0048869, GO:0050768, GO:0007275, GO:0008150, GO:0065007, GO:0044699, GO:0010721, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045596, GO:0045595, GO:0044763, GO:0051239, GO:0022008, GO:0051093, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0051960, GO:2000026, GO:0048731, GO:0048523
GO:0021913 [BP]regulation of transcription from RNA polymerase II promoter involved in ventral spinal cord interneuron specificationprobableGO:0048856, GO:0080090, GO:0019222, GO:0060573, GO:0021515, GO:0021514, GO:0021517, GO:0030154, GO:0021511, GO:0060579, GO:0021513, GO:0032501, GO:0007275, GO:0044699, GO:0007417, GO:0007389, GO:0048869, GO:0001708, GO:2000112, GO:0050789, GO:0008150, GO:0019219, GO:0060850, GO:0065007, GO:0031326, GO:0048731, GO:0010468, GO:0021953, GO:0032502, GO:0021521, GO:0048665, GO:0048663, GO:0030182, GO:0010556, GO:0060255, GO:0031323, GO:0009987, GO:0009889, GO:0021510, GO:0060581, GO:0003002, GO:2001141, GO:0022008, GO:0050794, GO:0048699, GO:0045165, GO:0009953, GO:0007399, GO:0044707, GO:0051252, GO:0006355, GO:0006357, GO:0044763, GO:0051171
GO:0021912 [BP]regulation of transcription from RNA polymerase II promoter involved in spinal cord motor neuron fate specificationprobableGO:0032502, GO:0051252, GO:0080090, GO:0019222, GO:0021515, GO:0031326, GO:0021517, GO:0030154, GO:0031323, GO:0021510, GO:0032501, GO:0007275, GO:0044699, GO:0007417, GO:0048869, GO:0001708, GO:2000112, GO:0050789, GO:0008150, GO:0019219, GO:0060850, GO:0065007, GO:0010468, GO:0021953, GO:0021520, GO:0021522, GO:0048665, GO:0048663, GO:0030182, GO:0010556, GO:0060255, GO:0009987, GO:0009889, GO:0050794, GO:0044763, GO:0051171, GO:2001141, GO:0022008, GO:0048699, GO:0045165, GO:0044707, GO:0007399, GO:0048856, GO:0006355, GO:0006357, GO:0048731
GO:0010454 [BP]negative regulation of cell fate commitmentprobableGO:0051093, GO:0050793, GO:0010453, GO:0050794, GO:0008150, GO:0045596, GO:0045595, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0010455 [BP]positive regulation of cell fate commitmentprobableGO:0051094, GO:0050793, GO:0010453, GO:0050794, GO:0045597, GO:0045595, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DA6, chain A
Confidence level:probable
Coverage over the Query: 1-23
View the alignment between query and template
View the model in PyMOL