Diaphorina citri psyllid: psy5401

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MKTHLPGYLAKEKDLKAKGIHEIFCIAVNDAFVMEAWCRKNNAEGKIRFLADPNLEFTKKLGVEHEIPVLGGWRSKRYSMVVDDGKITQLNIEPDGTGLTCSLVDELKL
ccccccHHHHcHHHHHcccccEEEEEEEccHHHHHHHHHHccccccCEEEEccccHHHHHccccccccccccccccCEEEEEEcccEEEEEEccccccCEECccccccc
*KTHLPGYLAKEKDLKAKGIHEIFCIAVNDAFVMEAWCRKNNAEGKIRFLADPNLEFTKKLGVEHEIPVLGGWRSKRYSMVVDDGKITQLNIEPDGTGLTCSLVDELKL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKTHLPGYLAKEKDLKAKGIHEIFCIAVNDAFVMEAWCRKNNAEGKIRFLADPNLEFTKKLGVEHEIPVLGGWRSKRYSMVVDDGKITQLNIEPDGTGLTCSLVDELKL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative peroxiredoxin pmp20 confidentO14313

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0006979 [BP]response to oxidative stressprobableGO:0006950, GO:0008150, GO:0050896
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0004601 [MF]peroxidase activityprobableGO:0003824, GO:0016209, GO:0016684, GO:0003674, GO:0016491
GO:0042592 [BP]homeostatic processprobableGO:0008150, GO:0065008, GO:0065007
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0051920 [MF]peroxiredoxin activityprobableGO:0003824, GO:0016705, GO:0003674, GO:0016491

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XHF, chain A
Confidence level:very confident
Coverage over the Query: 2-108
View the alignment between query and template
View the model in PyMOL