Psyllid ID: psy5401

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MKTHLPGYLAKEKDLKAKGIHEIFCIAVNDAFVMEAWCRKNNAEGKIRFLADPNLEFTKKLGVEHEIPVLGGWRSKRYSMVVDDGKITQLNIEPDGTGLTCSLVDELKL
ccccccHHHHcHHHHHHccccEEEEEEEccHHHHHHHHHHccccccEEEEEccccHHHHHHcccccccccccccccEEEEEEEcccEEEEEEccccccEEEEccccccc
cHcHHHHHHHcHHHHHcccccEEEEEEcccHHHHHHHHHHcccccccEEEEccccHHHHHcccEEcHHHHccccEccEEEEEEccEEEEEEEcccccccccccHHHHcc
mkthlpgylakekdlkaKGIHEIFCIAVNDAFVMEAWCRKNnaegkirfladpnleftkklgveheipvlggwrskrysmvvddgkitqlniepdgtgltcsLVDELKL
MKTHLPGYLAKEKDLKAKGIHEIFCIAVNDAFVMEAWCRKNNAEGKIRFLADPNLEFTKKLgveheipvlggwrskrySMVVDDGKitqlniepdgtgltcslvdelkl
MKTHLPGYLAKEKDLKAKGIHEIFCIAVNDAFVMEAWCRKNNAEGKIRFLADPNLEFTKKLGVEHEIPVLGGWRSKRYSMVVDDGKITQLNIEPDGTGLTCSLVDELKL
************KDLKAKGIHEIFCIAVNDAFVMEAWCRKNNAEGKIRFLADPNLEFTKKLGVEHEIPVLGGWRSKRYSMVVDDGKITQLNIEPDGTGLTCSLV*****
*KTHLPGYLAKEKDLKAKGIHEIFCIAVNDAFVMEAWCRKNNAEGKIRFLADPNLEFTKKLGVEHEIPVLGGWRSKRYSMVVDDGKITQLNIEPDGTGLTCSLVDELKL
MKTHLPGYLAKEKDLKAKGIHEIFCIAVNDAFVMEAWCRKNNAEGKIRFLADPNLEFTKKLGVEHEIPVLGGWRSKRYSMVVDDGKITQLNIEPDGTGLTCSLVDELKL
*KTHLPGYLAKEKDLKAKGIHEIFCIAVNDAFVMEAWCRKNNAEGKIRFLADPNLEFTKKLGVEHEIPVLGGWRSKRYSMVVDDGKITQLNIEPDGTGLTCSLVDELKL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKTHLPGYLAKEKDLKAKGIHEIFCIAVNDAFVMEAWCRKNNAEGKIRFLADPNLEFTKKLGVEHEIPVLGGWRSKRYSMVVDDGKITQLNIEPDGTGLTCSLVDELKL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query109 2.2.26 [Sep-21-2011]
Q9GLW7215 Peroxiredoxin-5, mitochon N/A N/A 0.972 0.493 0.495 2e-25
P30044214 Peroxiredoxin-5, mitochon yes N/A 0.972 0.495 0.495 2e-25
Q9GLW9215 Peroxiredoxin-5, mitochon N/A N/A 0.972 0.493 0.486 6e-25
Q9BGI1219 Peroxiredoxin-5, mitochon yes N/A 0.972 0.484 0.495 2e-24
P99029210 Peroxiredoxin-5, mitochon yes N/A 0.972 0.504 0.495 4e-24
Q9R063213 Peroxiredoxin-5, mitochon yes N/A 0.972 0.497 0.477 5e-23
Q949U7234 Peroxiredoxin-2E, chlorop yes N/A 0.963 0.448 0.462 5e-20
Q7F8S5225 Peroxiredoxin-2E-2, chlor yes N/A 0.963 0.466 0.431 3e-18
O22711162 Peroxiredoxin-2D OS=Arabi no N/A 0.972 0.654 0.401 5e-17
Q9SRZ4162 Peroxiredoxin-2C OS=Arabi no N/A 0.972 0.654 0.401 6e-17
>sp|Q9GLW7|PRDX5_CHLAE Peroxiredoxin-5, mitochondrial OS=Chlorocebus aethiops GN=PRDX5 PE=2 SV=1 Back     alignment and function desciption
 Score =  114 bits (285), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 54/109 (49%), Positives = 73/109 (66%), Gaps = 3/109 (2%)

Query: 2   KTHLPGYLAKEKDLKAKGIHEIFCIAVNDAFVMEAWCRKNNAEGKIRFLADPNLEFTKKL 61
           KTHLPG++ + + LKAKG+  + C++VNDAFV   W R + AEGK+R LADP   F K+ 
Sbjct: 103 KTHLPGFVEQAEALKAKGVQVLACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKET 162

Query: 62  GV---EHEIPVLGGWRSKRYSMVVDDGKITQLNIEPDGTGLTCSLVDEL 107
            +   +  + + G  R KR+SMVV DG +  LN+EPDGTGLTCSL   +
Sbjct: 163 DLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPSI 211
Reduces hydrogen peroxide and alkyl hydroperoxides with reducing equivalents provided through the thioredoxin system. Involved in intracellular redox signaling.
Chlorocebus aethiops (taxid: 9534)
EC: 1EC: .EC: 1EC: 1EC: .EC: 1EC: .EC: 1EC: 5
>sp|P30044|PRDX5_HUMAN Peroxiredoxin-5, mitochondrial OS=Homo sapiens GN=PRDX5 PE=1 SV=4 Back     alignment and function description
>sp|Q9GLW9|PRDX5_PAPHA Peroxiredoxin-5, mitochondrial OS=Papio hamadryas GN=PRDX5 PE=2 SV=1 Back     alignment and function description
>sp|Q9BGI1|PRDX5_BOVIN Peroxiredoxin-5, mitochondrial OS=Bos taurus GN=PRDX5 PE=2 SV=2 Back     alignment and function description
>sp|P99029|PRDX5_MOUSE Peroxiredoxin-5, mitochondrial OS=Mus musculus GN=Prdx5 PE=1 SV=2 Back     alignment and function description
>sp|Q9R063|PRDX5_RAT Peroxiredoxin-5, mitochondrial OS=Rattus norvegicus GN=Prdx5 PE=1 SV=1 Back     alignment and function description
>sp|Q949U7|PRX2E_ARATH Peroxiredoxin-2E, chloroplastic OS=Arabidopsis thaliana GN=PRXIIE PE=1 SV=2 Back     alignment and function description
>sp|Q7F8S5|PR2E2_ORYSJ Peroxiredoxin-2E-2, chloroplastic OS=Oryza sativa subsp. japonica GN=PRXIIE-2 PE=1 SV=1 Back     alignment and function description
>sp|O22711|PRX2D_ARATH Peroxiredoxin-2D OS=Arabidopsis thaliana GN=PRXIID PE=1 SV=2 Back     alignment and function description
>sp|Q9SRZ4|PRX2C_ARATH Peroxiredoxin-2C OS=Arabidopsis thaliana GN=PRXIIC PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
328787790185 PREDICTED: peroxiredoxin-5, mitochondria 0.990 0.583 0.648 2e-35
380021499158 PREDICTED: peroxiredoxin-5, mitochondria 0.990 0.683 0.638 1e-34
380021497186 PREDICTED: peroxiredoxin-5, mitochondria 0.990 0.580 0.638 1e-34
429326693183 peroxiredoxin-like protein [Coptotermes 0.990 0.590 0.611 4e-34
91080447156 PREDICTED: similar to peroxiredoxin-like 0.990 0.692 0.620 4e-34
340712562186 PREDICTED: peroxiredoxin-5, mitochondria 0.990 0.580 0.601 8e-34
157361539182 peroxiredoxin-like protein [Phlebotomus 0.990 0.593 0.611 1e-33
296936619158 putative peroxiredoxin [Phlebotomus pern 0.990 0.683 0.611 2e-33
312373818172 hypothetical protein AND_16974 [Anophele 0.990 0.627 0.611 2e-33
323320784157 peroxiredoxin 5 [Brachymyrmex patagonicu 0.990 0.687 0.601 3e-33
>gi|328787790|ref|XP_624806.3| PREDICTED: peroxiredoxin-5, mitochondrial [Apis mellifera] Back     alignment and taxonomy information
 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 70/108 (64%), Positives = 86/108 (79%)

Query: 2   KTHLPGYLAKEKDLKAKGIHEIFCIAVNDAFVMEAWCRKNNAEGKIRFLADPNLEFTKKL 61
           KTHLPGY+ K  DLK+KGI EIFCI+VND FVM AW +   AEGK+R LADP  +FT  L
Sbjct: 78  KTHLPGYIQKASDLKSKGISEIFCISVNDPFVMAAWGKAQGAEGKVRMLADPAAQFTDAL 137

Query: 62  GVEHEIPVLGGWRSKRYSMVVDDGKITQLNIEPDGTGLTCSLVDELKL 109
            +  ++PVLGG RSKRYSMV+D+G IT+LNIEPD TGL+CSLV+ +K+
Sbjct: 138 ELSVDLPVLGGKRSKRYSMVLDNGIITELNIEPDNTGLSCSLVENIKV 185

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|380021499|ref|XP_003694602.1| PREDICTED: peroxiredoxin-5, mitochondrial-like isoform 2 [Apis florea] Back     alignment and taxonomy information
>gi|380021497|ref|XP_003694601.1| PREDICTED: peroxiredoxin-5, mitochondrial-like isoform 1 [Apis florea] Back     alignment and taxonomy information
>gi|429326693|gb|AFZ78682.1| peroxiredoxin-like protein [Coptotermes formosanus] Back     alignment and taxonomy information
>gi|91080447|ref|XP_969254.1| PREDICTED: similar to peroxiredoxin-like protein [Tribolium castaneum] gi|270005571|gb|EFA02019.1| hypothetical protein TcasGA2_TC007642 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|340712562|ref|XP_003394825.1| PREDICTED: peroxiredoxin-5, mitochondrial-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|157361539|gb|ABV44727.1| peroxiredoxin-like protein [Phlebotomus papatasi] Back     alignment and taxonomy information
>gi|296936619|gb|ADH94060.1| putative peroxiredoxin [Phlebotomus perniciosus] Back     alignment and taxonomy information
>gi|312373818|gb|EFR21501.1| hypothetical protein AND_16974 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|323320784|gb|ADX36414.1| peroxiredoxin 5 [Brachymyrmex patagonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
FB|FBgn0038570190 Prx5 "Peroxiredoxin 5" [Drosop 0.972 0.557 0.579 1.4e-30
ZFIN|ZDB-GENE-050522-159190 prdx5 "peroxiredoxin 5" [Danio 0.935 0.536 0.537 1e-27
UNIPROTKB|F1RQP0162 PRDX5 "Uncharacterized protein 0.972 0.654 0.495 5.9e-25
UNIPROTKB|Q9BGI1219 PRDX5 "Peroxiredoxin-5, mitoch 0.972 0.484 0.513 1.2e-24
UNIPROTKB|F1PFI3197 PLCB3 "Uncharacterized protein 0.972 0.538 0.486 1.6e-24
UNIPROTKB|P30044214 PRDX5 "Peroxiredoxin-5, mitoch 0.972 0.495 0.495 2.6e-24
MGI|MGI:1859821210 Prdx5 "peroxiredoxin 5" [Mus m 0.972 0.504 0.486 1.1e-23
RGD|71007213 Prdx5 "peroxiredoxin 5" [Rattu 0.972 0.497 0.477 6.1e-23
UNIPROTKB|Q8E8M3158 SO_4640 "Antioxidant AhpC/Tsa 0.834 0.575 0.489 9.2e-20
TIGR_CMR|SO_4640158 SO_4640 "antioxidant, AhpC/Tsa 0.834 0.575 0.489 9.2e-20
FB|FBgn0038570 Prx5 "Peroxiredoxin 5" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 337 (123.7 bits), Expect = 1.4e-30, P = 1.4e-30
 Identities = 62/107 (57%), Positives = 84/107 (78%)

Query:     2 KTHLPGYLAKEKDLKAK-GIHEIFCIAVNDAFVMEAWCRKNNAEGKIRFLADPNLEFTKK 60
             KTHLPGY++   +LK+K G+ EI C++VND FVM AW +++ A GK+R LADP   FTK 
Sbjct:    81 KTHLPGYVSSADELKSKQGVDEIVCVSVNDPFVMSAWGKEHGAAGKVRLLADPAGGFTKA 140

Query:    61 LGVEHEIPVLGGWRSKRYSMVVDDGKITQLNIEPDGTGLTCSLVDEL 107
             L V  ++P LGG RSKRYS+VV++GK+T+LN+EPDGTGL+CSL + +
Sbjct:   141 LDVTIDLPPLGGVRSKRYSLVVENGKVTELNVEPDGTGLSCSLANNI 187
GO:0005777 "peroxisome" evidence=ISS
GO:0016209 "antioxidant activity" evidence=ISS
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0006979 "response to oxidative stress" evidence=IMP
GO:0005634 "nucleus" evidence=IDA
GO:0005739 "mitochondrion" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0043066 "negative regulation of apoptotic process" evidence=IGI;IMP
GO:0045454 "cell redox homeostasis" evidence=IGI
GO:0008340 "determination of adult lifespan" evidence=IMP
ZFIN|ZDB-GENE-050522-159 prdx5 "peroxiredoxin 5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RQP0 PRDX5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BGI1 PRDX5 "Peroxiredoxin-5, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PFI3 PLCB3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P30044 PRDX5 "Peroxiredoxin-5, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1859821 Prdx5 "peroxiredoxin 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|71007 Prdx5 "peroxiredoxin 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8E8M3 SO_4640 "Antioxidant AhpC/Tsa family" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|SO_4640 SO_4640 "antioxidant, AhpC/Tsa family" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O14313PMP20_SCHPO1, ., 1, 1, ., 1, ., 1, 50.39440.97240.6794yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
cd03013155 cd03013, PRX5_like, Peroxiredoxin (PRX) family, PR 2e-49
COG0678165 COG0678, AHP1, Peroxiredoxin [Posttranslational mo 4e-43
cd02971140 cd02971, PRX_family, Peroxiredoxin (PRX) family; c 1e-22
pfam08534142 pfam08534, Redoxin, Redoxin 1e-19
pfam00578124 pfam00578, AhpC-TSA, AhpC/TSA family 8e-06
COG0450194 COG0450, AhpC, Peroxiredoxin [Posttranslational mo 6e-05
TIGR03137187 TIGR03137, AhpC, peroxiredoxin 8e-04
cd03015173 cd03015, PRX_Typ2cys, Peroxiredoxin (PRX) family, 0.003
>gnl|CDD|239311 cd03013, PRX5_like, Peroxiredoxin (PRX) family, PRX5-like subfamily; members are similar to the human protein, PRX5, a homodimeric TRX peroxidase, widely expressed in tissues and found cellularly in mitochondria, peroxisomes and the cytosol Back     alignment and domain information 
 Score =  153 bits (390), Expect = 2e-49
 Identities = 51/107 (47%), Positives = 71/107 (66%), Gaps = 1/107 (0%)

Query: 2   KTHLPGYLAKEKDLKAKGIHEIFCIAVNDAFVMEAWCRKNNAEGKIRFLADPNLEFTKKL 61
             HLPGY+    +LKAKG+ E+ C++VND FVM+AW +   A+ KIRFLAD N EFTK L
Sbjct: 47  AQHLPGYVENADELKAKGVDEVICVSVNDPFVMKAWGKALGAKDKIRFLADGNGEFTKAL 106

Query: 62  GVEHEI-PVLGGWRSKRYSMVVDDGKITQLNIEPDGTGLTCSLVDEL 107
           G+  ++    GG RSKRY+++VDDGK+  L +E D   +  S  + +
Sbjct: 107 GLTLDLSAAGGGIRSKRYALIVDDGKVKYLFVEEDPGDVEVSSAENV 153

The cellular location of PRX5 suggests that it may have an important antioxidant role in organelles that are major sources of reactive oxygen species (ROS), as well as a role in the control of signal transduction. PRX5 has been shown to reduce hydrogen peroxide, alkyl hydroperoxides and peroxynitrite. As with all other PRXs, the N-terminal peroxidatic cysteine of PRX5 is oxidized into a sulfenic acid intermediate upon reaction with peroxides. Human PRX5 is able to resolve this intermediate by forming an intramolecular disulfide bond with its C-terminal cysteine (the resolving cysteine), which can then be reduced by TRX, just like an atypical 2-cys PRX. This resolving cysteine, however, is not conserved in other members of the subfamily. In such cases, it is assumed that the oxidized cysteine is directly resolved by an external small-molecule or protein reductant, typical of a 1-cys PRX. In the case of the H. influenza PRX5 hybrid, the resolving glutaredoxin domain is on the same protein chain as PRX. PRX5 homodimers show an A-type interface, similar to atypical 2-cys PRXs. Length = 155
>gnl|CDD|223750 COG0678, AHP1, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|239269 cd02971, PRX_family, Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>gnl|CDD|219888 pfam08534, Redoxin, Redoxin Back     alignment and domain information
>gnl|CDD|216002 pfam00578, AhpC-TSA, AhpC/TSA family Back     alignment and domain information
>gnl|CDD|223527 COG0450, AhpC, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|211789 TIGR03137, AhpC, peroxiredoxin Back     alignment and domain information
>gnl|CDD|239313 cd03015, PRX_Typ2cys, Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 109
COG0678165 AHP1 Peroxiredoxin [Posttranslational modification 100.0
KOG0541|consensus171 100.0
cd03013155 PRX5_like Peroxiredoxin (PRX) family, PRX5-like su 99.96
COG0450194 AhpC Peroxiredoxin [Posttranslational modification 99.89
COG1225157 Bcp Peroxiredoxin [Posttranslational modification, 99.88
PRK10382187 alkyl hydroperoxide reductase subunit C; Provision 99.83
PTZ00137261 2-Cys peroxiredoxin; Provisional 99.81
PRK13191215 putative peroxiredoxin; Provisional 99.79
KOG0852|consensus196 99.79
PRK15000200 peroxidase; Provisional 99.78
PRK13189222 peroxiredoxin; Provisional 99.76
PRK13599215 putative peroxiredoxin; Provisional 99.76
cd03016203 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub 99.75
PRK13190202 putative peroxiredoxin; Provisional 99.74
TIGR03137187 AhpC peroxiredoxin. This gene contains two invaria 99.72
COG2077158 Tpx Peroxiredoxin [Posttranslational modification, 99.69
cd02971140 PRX_family Peroxiredoxin (PRX) family; composed of 99.63
PRK00522167 tpx lipid hydroperoxide peroxidase; Provisional 99.63
PTZ00253199 tryparedoxin peroxidase; Provisional 99.62
cd03014143 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 99.6
KOG0855|consensus211 99.57
cd03015173 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- 99.53
cd03018149 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik 99.5
cd02970149 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot 99.49
PRK09437154 bcp thioredoxin-dependent thiol peroxidase; Review 99.46
cd03017140 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit 99.46
PF00578124 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per 99.41
PF08534146 Redoxin: Redoxin; InterPro: IPR013740 This redoxin 99.28
cd03012126 TlpA_like_DipZ_like TlpA-like family, DipZ-like su 99.15
KOG0854|consensus224 99.05
cd00340152 GSH_Peroxidase Glutathione (GSH) peroxidase family 99.02
cd02968142 SCO SCO (an acronym for Synthesis of Cytochrome c 98.96
cd02969171 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot 98.96
PLN02412167 probable glutathione peroxidase 98.92
TIGR02540153 gpx7 putative glutathione peroxidase Gpx7. This mo 98.89
PTZ00256183 glutathione peroxidase; Provisional 98.71
PRK15412185 thiol:disulfide interchange protein DsbE; Provisio 98.53
PTZ00056199 glutathione peroxidase; Provisional 98.49
PRK03147173 thiol-disulfide oxidoreductase; Provisional 98.46
TIGR00385173 dsbE periplasmic protein thiol:disulfide oxidoredu 98.37
PLN02399236 phospholipid hydroperoxide glutathione peroxidase 98.33
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 98.32
PF13911115 AhpC-TSA_2: AhpC/TSA antioxidant enzyme 98.27
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known 98.17
cd02967114 mauD Methylamine utilization (mau) D family; mauD 98.03
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 97.85
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, R 97.81
TIGR02661189 MauD methylamine dehydrogenase accessory protein M 97.78
TIGR01626184 ytfJ_HI0045 conserved hypothetical protein YtfJ-fa 97.68
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family 97.17
PRK10606183 btuE putative glutathione peroxidase; Provisional 97.05
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; 97.02
PRK14018 521 trifunctional thioredoxin/methionine sulfoxide red 96.99
PF1390595 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ 96.74
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 96.52
PRK13728181 conjugal transfer protein TrbB; Provisional 94.62
PF02630174 SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This fam 93.94
PF05988211 DUF899: Bacterial protein of unknown function (DUF 92.82
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 89.18
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 88.43
PF00837237 T4_deiodinase: Iodothyronine deiodinase; InterPro: 81.85
PF09695160 YtfJ_HI0045: Bacterial protein of unknown function 81.67
cd05017119 SIS_PGI_PMI_1 The members of this protein family c 80.46
>COG0678 AHP1 Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=6.7e-40  Score=230.93  Aligned_cols=108  Identities=49%  Similarity=0.855  Sum_probs=103.5

Q ss_pred             CCcchhHHHcHHHHHhCCCCEEEEEecCCHHHHHHHHHhcCCCCceEEeecCCchHhHhhCCccccccCC-ceeEeEEEE
Q psy5401           2 KTHLPGYLAKEKDLKAKGIHEIFCIAVNDAFVMEAWCRKNNAEGKIRFLADPNLEFTKKLGVEHEIPVLG-GWRSKRYSM   80 (109)
Q Consensus         2 ~~hlp~f~~~~~~f~~~Gvd~V~~iS~dd~f~~~aW~~~~~~~~~i~~lsD~~~~~~k~~G~~~~~~~~G-g~r~~R~~f   80 (109)
                      ++|||+|++++++|+++|||+|+|||+||+|||+||++.++..++|.||+|++++|+|++|++.+.+.+| |.||+||++
T Consensus        55 ~~hlPgY~~~~d~f~~kGVD~I~cVSVND~FVm~AWak~~g~~~~I~fi~Dg~geFTk~~Gm~~d~~~~g~G~RS~RYsm  134 (165)
T COG0678          55 SSHLPGYLELADEFKAKGVDEIYCVSVNDAFVMNAWAKSQGGEGNIKFIPDGNGEFTKAMGMLVDKSDLGFGVRSWRYSM  134 (165)
T ss_pred             cccCccHHHHHHHHHHcCCceEEEEEeCcHHHHHHHHHhcCCCccEEEecCCCchhhhhcCceeecccCCcceeeeeEEE
Confidence            4699999999999999999999999999999999999999998789999999999999999999987777 899999999


Q ss_pred             EEeCCeEEEEEEecCCCceeeeccccccC
Q psy5401          81 VVDDGKITQLNIEPDGTGLTCSLVDELKL  109 (109)
Q Consensus        81 iVddG~V~~~~v~~~~~~~~~s~a~~vl~  109 (109)
                      ||+||+|+++++|++++++++|+||+||+
T Consensus       135 vV~nGvV~~~~iE~p~~~~~vS~a~~mL~  163 (165)
T COG0678         135 VVENGVVEKLFIEPPGDPFTVSSADTMLA  163 (165)
T ss_pred             EEeCCeEEEEEecCCCCceeecCHHHHHh
Confidence            99999999999999888899999999985

>KOG0541|consensus Back     alignment and domain information
>cd03013 PRX5_like Peroxiredoxin (PRX) family, PRX5-like subfamily; members are similar to the human protein, PRX5, a homodimeric TRX peroxidase, widely expressed in tissues and found cellularly in mitochondria, peroxisomes and the cytosol Back     alignment and domain information
>COG0450 AhpC Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional Back     alignment and domain information
>PTZ00137 2-Cys peroxiredoxin; Provisional Back     alignment and domain information
>PRK13191 putative peroxiredoxin; Provisional Back     alignment and domain information
>KOG0852|consensus Back     alignment and domain information
>PRK15000 peroxidase; Provisional Back     alignment and domain information
>PRK13189 peroxiredoxin; Provisional Back     alignment and domain information
>PRK13599 putative peroxiredoxin; Provisional Back     alignment and domain information
>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine Back     alignment and domain information
>PRK13190 putative peroxiredoxin; Provisional Back     alignment and domain information
>TIGR03137 AhpC peroxiredoxin Back     alignment and domain information
>COG2077 Tpx Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>PRK00522 tpx lipid hydroperoxide peroxidase; Provisional Back     alignment and domain information
>PTZ00253 tryparedoxin peroxidase; Provisional Back     alignment and domain information
>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) Back     alignment and domain information
>KOG0855|consensus Back     alignment and domain information
>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE Back     alignment and domain information
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed Back     alignment and domain information
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells Back     alignment and domain information
>PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins Back     alignment and domain information
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
>KOG0854|consensus Back     alignment and domain information
>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate Back     alignment and domain information
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold Back     alignment and domain information
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>PLN02412 probable glutathione peroxidase Back     alignment and domain information
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7 Back     alignment and domain information
>PTZ00256 glutathione peroxidase; Provisional Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>PTZ00056 glutathione peroxidase; Provisional Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>PLN02399 phospholipid hydroperoxide glutathione peroxidase Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>PF13911 AhpC-TSA_2: AhpC/TSA antioxidant enzyme Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD Back     alignment and domain information
>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>PRK10606 btuE putative glutathione peroxidase; Provisional Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PF02630 SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This family is involved in biogenesis of respiratory and photosynthetic systems Back     alignment and domain information
>PF05988 DUF899: Bacterial protein of unknown function (DUF899); InterPro: IPR010296 This family consists of uncharacterised bacterial proteins of unknown function which are thioredoxin-like Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>PF00837 T4_deiodinase: Iodothyronine deiodinase; InterPro: IPR000643 Iodothyronine deiodinase (1 Back     alignment and domain information
>PF09695 YtfJ_HI0045: Bacterial protein of unknown function (YtfJ_HI0045); InterPro: IPR006513 These are sequences from gammaproteobacteria that are related to the Escherichia coli protein, YtfJ Back     alignment and domain information
>cd05017 SIS_PGI_PMI_1 The members of this protein family contain the SIS (Sugar ISomerase) domain and have both the phosphoglucose isomerase (PGI) and the phosphomannose isomerase (PMI) functions Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
2wfc_A167 Crystal Structure Of Peroxiredoxin 5 From Arenicola 7e-28
1urm_A172 Human Peroxiredoxin 5, C47s Mutant Length = 172 1e-26
1oc3_A172 Human Peroxiredoxin 5 Length = 172 2e-26
3mng_A173 Wild Type Human Prxv With Dtt Bound As A Competitiv 2e-26
1hd2_A161 Human Peroxiredoxin 5 Length = 161 2e-26
2vl9_A173 Oxidized Form Of Human Peroxiredoxin 5 Length = 173 1e-25
2vl2_A172 Oxidized And Reduced Forms Of Human Peroxiredoxin 5 2e-25
2xhf_A171 Crystal Structure Of Peroxiredoxin 5 From Alvinella 3e-22
4f82_A176 X-Ray Crystal Structure Of A Putative Thioredoxin R 4e-20
1tp9_A162 Prx D (Type Ii) From Populus Tremula Length = 162 6e-19
3uma_A184 Crystal Structure Of A Hypothetical Peroxiredoxin P 1e-16
2pwj_A171 Structure Of A Mitochondrial Type Ii Peroxiredoxin 3e-12
1nm3_A241 Crystal Structure Of Heamophilus Influenza Hybrid-p 3e-09
4dss_A176 Crystal Structure Of Peroxiredoxin Ahp1 From Saccha 8e-09
4dsq_A184 Crystal Structure Of Peroxiredoxin Ahp1 From Saccha 8e-09
4h86_A199 Crystal Structure Of Ahp1 From Saccharomyces Cerevi 9e-09
1xiy_A182 Crystal Structure Of Plasmodium Falciparum Antioxid 2e-04
>pdb|2WFC|A Chain A, Crystal Structure Of Peroxiredoxin 5 From Arenicola Marina Length = 167 Back     alignment and structure 
Iteration: 1

 Score =  118 bits (296), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 78/107 (72%), Gaps = 1/107 (0%)
Query: 2   KTHLPGYLAKEKDLKAKGIHEIFCIAVNDAFVMEAWCRKNNAEGKIRFLADPNLEFTKKL 61
           KTHLPGY+ +   +  KG+  I C+AVND+FVM+AW + + A+ K++ LADP   FTK +
Sbjct: 49  KTHLPGYVEQAAAIHGKGVDIIACMAVNDSFVMDAWGKAHGADDKVQMLADPGGAFTKAV 108
Query: 62  GVEHEI-PVLGGWRSKRYSMVVDDGKITQLNIEPDGTGLTCSLVDEL 107
            +E ++  VLG  RSKRYS+V++DG +T++N+EPDG GLTCSL   +
Sbjct: 109 DMELDLSAVLGNVRSKRYSLVIEDGVVTKVNVEPDGKGLTCSLAPNI 155
>pdb|1URM|A Chain A, Human Peroxiredoxin 5, C47s Mutant Length = 172 Back     alignment and structure
>pdb|1OC3|A Chain A, Human Peroxiredoxin 5 Length = 172 Back     alignment and structure
>pdb|3MNG|A Chain A, Wild Type Human Prxv With Dtt Bound As A Competitive Inhibitor Length = 173 Back     alignment and structure
>pdb|1HD2|A Chain A, Human Peroxiredoxin 5 Length = 161 Back     alignment and structure
>pdb|2VL9|A Chain A, Oxidized Form Of Human Peroxiredoxin 5 Length = 173 Back     alignment and structure
>pdb|2VL2|A Chain A, Oxidized And Reduced Forms Of Human Peroxiredoxin 5 Length = 172 Back     alignment and structure
>pdb|2XHF|A Chain A, Crystal Structure Of Peroxiredoxin 5 From Alvinella Pompejana Length = 171 Back     alignment and structure
>pdb|4F82|A Chain A, X-Ray Crystal Structure Of A Putative Thioredoxin Reductase From Burkholderia Cenocepacia Length = 176 Back     alignment and structure
>pdb|1TP9|A Chain A, Prx D (Type Ii) From Populus Tremula Length = 162 Back     alignment and structure
>pdb|3UMA|A Chain A, Crystal Structure Of A Hypothetical Peroxiredoxin Protein Frm Sinorhizobium Meliloti Length = 184 Back     alignment and structure
>pdb|2PWJ|A Chain A, Structure Of A Mitochondrial Type Ii Peroxiredoxin From Pisum Sativum Length = 171 Back     alignment and structure
>pdb|1NM3|A Chain A, Crystal Structure Of Heamophilus Influenza Hybrid-prx5 Length = 241 Back     alignment and structure
>pdb|4DSS|A Chain A, Crystal Structure Of Peroxiredoxin Ahp1 From Saccharomyces Cerevisiae In Complex With Thioredoxin Trx2 Length = 176 Back     alignment and structure
>pdb|4DSQ|A Chain A, Crystal Structure Of Peroxiredoxin Ahp1 From Saccharomyces Cerevisiae In Oxidized Form Length = 184 Back     alignment and structure
>pdb|4H86|A Chain A, Crystal Structure Of Ahp1 From Saccharomyces Cerevisiae In Reduced Form Length = 199 Back     alignment and structure
>pdb|1XIY|A Chain A, Crystal Structure Of Plasmodium Falciparum Antioxidant Protein (1-Cys Peroxiredoxin) Length = 182 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
2xhf_A171 Peroxiredoxin 5; oxidoreductase, antioxidant enzym 2e-55
3mng_A173 Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, 7e-55
2wfc_A167 Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan 4e-54
2pwj_A171 Mitochondrial peroxiredoxin; alpha and beta protei 4e-52
3uma_A184 Hypothetical peroxiredoxin protein; nysgrc, PSI bi 5e-52
4f82_A176 Thioredoxin reductase; structural genomics, niaid, 1e-50
1tp9_A162 Peroxiredoxin, PRX D (type II); oligomer, thioredo 8e-50
4dss_A176 Peroxiredoxin type-2; electron transport, oxidored 2e-46
1xiy_A182 Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin 4e-45
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 2e-44
2yzh_A171 Probable thiol peroxidase; redox protein, antioxid 1e-05
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 6e-05
3keb_A224 Probable thiol peroxidase; structural genomics, AP 1e-04
1xvq_A175 Thiol peroxidase; thioredoxin fold, structural gen 1e-04
2jsy_A167 Probable thiol peroxidase; solution structure, ant 1e-04
1q98_A165 Thiol peroxidase, TPX; structural genomics, NYSGXR 1e-04
3zrd_A200 Thiol peroxidase; oxidoreductase, 2Cys peroxiredox 2e-04
3p7x_A166 Probable thiol peroxidase; thioredoxin fold, oxido 2e-04
1we0_A187 Alkyl hydroperoxide reductase C; peroxiredoxin, AH 4e-04
1psq_A163 Probable thiol peroxidase; structural genomics, NY 6e-04
>2xhf_A Peroxiredoxin 5; oxidoreductase, antioxidant enzymes; 1.30A {Alvinella pompejana} Length = 171 Back     alignment and structure
 Score =  168 bits (428), Expect = 2e-55
 Identities = 49/106 (46%), Positives = 65/106 (61%), Gaps = 1/106 (0%)

Query: 2   KTHLPGYLAKEKDLKAKGIHEIFCIAVNDAFVMEAWCRKNNAEGKIRFLADPNLEFTKKL 61
             H+P YL+     K +G H I CIAVND FVM AW +  + E KIR LAD + EFT+ L
Sbjct: 59  NNHIPEYLSLYDKFKEEGYHTIACIAVNDPFVMAAWGKTVDPEHKIRMLADMHGEFTRAL 118

Query: 62  GVEHEIPVLG-GWRSKRYSMVVDDGKITQLNIEPDGTGLTCSLVDE 106
           G E +   +    RS+RY+M++DD KI  ++ EPD TGL C L  +
Sbjct: 119 GTELDSSKMLGNNRSRRYAMLIDDNKIRSVSTEPDITGLACLLSIQ 164
>3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A Length = 173 Back     alignment and structure
>2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} Length = 167 Back     alignment and structure
>2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} Length = 171 Back     alignment and structure
>3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti} Length = 184 Back     alignment and structure
>4f82_A Thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.85A {Burkholderia cenocepacia} Length = 176 Back     alignment and structure
>1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 Length = 162 Back     alignment and structure
>4dss_A Peroxiredoxin type-2; electron transport, oxidoreductase, peroxiredoxin, alkyl hydroperoxid reductase; 2.10A {Saccharomyces cerevisiae} PDB: 4dsq_A 4dsr_A Length = 176 Back     alignment and structure
>1xiy_A Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin fold, peroxiredoxin fold, oxidoreductase; 1.80A {Plasmodium falciparum} SCOP: c.47.1.10 Length = 182 Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Length = 241 Back     alignment and structure
>2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} Length = 171 Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Length = 195 Back     alignment and structure
>3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, Pro structure initiative; HET: MSE; 1.80A {Chromobacterium violaceum} Length = 224 Back     alignment and structure
>1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A Length = 175 Back     alignment and structure
>2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A Length = 167 Back     alignment and structure
>1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 Length = 165 Back     alignment and structure
>3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A Length = 200 Back     alignment and structure
>3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} Length = 166 Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Length = 187 Back     alignment and structure
>1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 Length = 163 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
4h86_A199 Peroxiredoxin type-2; oxidoreductase; 2.00A {Sacch 100.0
2xhf_A171 Peroxiredoxin 5; oxidoreductase, antioxidant enzym 99.97
4f82_A176 Thioredoxin reductase; structural genomics, niaid, 99.96
1xiy_A182 Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin 99.95
3mng_A173 Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, 99.92
3uma_A184 Hypothetical peroxiredoxin protein; nysgrc, PSI bi 99.92
2pwj_A171 Mitochondrial peroxiredoxin; alpha and beta protei 99.88
3sbc_A216 Peroxiredoxin TSA1; alpha-beta fold, peroxidase, c 99.88
1tp9_A162 Peroxiredoxin, PRX D (type II); oligomer, thioredo 99.87
2wfc_A167 Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan 99.87
3tue_A219 Tryparedoxin peroxidase; thioredoxin fold, peroxir 99.86
4gqc_A164 Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f 99.81
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 99.78
4g2e_A157 Peroxiredoxin; redox protein, structural genomics, 99.78
3keb_A224 Probable thiol peroxidase; structural genomics, AP 99.68
1xcc_A220 1-Cys peroxiredoxin; unknown function, structural 99.65
2v2g_A233 Peroxiredoxin 6; oxidoreductase, antioxidant enzym 99.65
3tjj_A254 Peroxiredoxin-4; thioredoxin fold, sulfenylation, 99.63
1prx_A224 HORF6; peroxiredoxin, hydrogen peroxide, redox reg 99.62
3a2v_A249 Probable peroxiredoxin; thioredoxin peroxidase, hy 99.61
4eo3_A 322 Bacterioferritin comigratory protein/NADH dehydro; 99.61
3qpm_A240 Peroxiredoxin; oxidoreductase, thioredoxin fold, p 99.6
1n8j_A186 AHPC, alkyl hydroperoxide reductase C22 protein; p 99.6
2pn8_A211 Peroxiredoxin-4; thioredoxin, oxidoreductase, stru 99.56
2c0d_A221 Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th 99.55
3ixr_A179 Bacterioferritin comigratory protein; alpha beta p 99.52
2i81_A213 2-Cys peroxiredoxin; structural genomics consortiu 99.51
3gkn_A163 Bacterioferritin comigratory protein; BCP, PRX, at 99.5
2h01_A192 2-Cys peroxiredoxin; thioredoxin peroxidase, struc 99.48
1zye_A220 Thioredoxin-dependent peroxide reductase; catenane 99.47
1q98_A165 Thiol peroxidase, TPX; structural genomics, NYSGXR 99.45
1uul_A202 Tryparedoxin peroxidase homologue; peroxiredoxin, 99.45
3p7x_A166 Probable thiol peroxidase; thioredoxin fold, oxido 99.44
3zrd_A200 Thiol peroxidase; oxidoreductase, 2Cys peroxiredox 99.43
1psq_A163 Probable thiol peroxidase; structural genomics, NY 99.43
2a4v_A159 Peroxiredoxin DOT5; yeast nuclear thiol peroxidase 99.39
3ztl_A222 Thioredoxin peroxidase; oxidoreductase, reductase, 99.39
1qmv_A197 Human thioredoxin peroxidase-B; peroxiredoxin, sul 99.39
2yzh_A171 Probable thiol peroxidase; redox protein, antioxid 99.35
1we0_A187 Alkyl hydroperoxide reductase C; peroxiredoxin, AH 99.35
3drn_A161 Peroxiredoxin, bacterioferritin comigratory prote 99.33
1zof_A198 Alkyl hydroperoxide-reductase; decamer, toroide-sh 99.3
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 99.25
1xvw_A160 Hypothetical protein RV2238C/MT2298; thioredoxin f 99.2
1xvq_A175 Thiol peroxidase; thioredoxin fold, structural gen 99.17
2jsy_A167 Probable thiol peroxidase; solution structure, ant 99.17
3u5r_E218 Uncharacterized protein; structural genomics, PSI- 99.0
1xzo_A174 BSSCO, hypothetical protein YPMQ; thioredoxin-like 98.8
2k6v_A172 Putative cytochrome C oxidase assembly protein; th 98.78
2ywi_A196 Hypothetical conserved protein; uncharacterized co 98.77
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 98.74
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 98.71
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 98.7
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 98.69
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 98.68
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 98.67
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 98.64
2cvb_A188 Probable thiol-disulfide isomerase/thioredoxin; re 98.64
2ggt_A164 SCO1 protein homolog, mitochondrial; copper chaper 98.62
3me7_A170 Putative uncharacterized protein; electron transfe 98.59
2rli_A171 SCO2 protein homolog, mitochondrial; copper protei 98.58
2lrn_A152 Thiol:disulfide interchange protein; structural ge 98.58
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 98.55
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 98.55
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 98.55
2b7k_A200 SCO1 protein; metallochaperone, cytochrome C oxida 98.53
3raz_A151 Thioredoxin-related protein; structural genomics, 98.51
2obi_A183 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 98.49
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 98.48
2i3y_A215 Epididymal secretory glutathione peroxidase; thior 98.48
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 98.48
2r37_A207 Glutathione peroxidase 3; plasma, structural genom 98.47
2gs3_A185 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 98.47
2l5o_A153 Putative thioredoxin; structural genomics, unknown 98.44
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like 98.44
2lrt_A152 Uncharacterized protein; structural genomics, thio 98.43
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 98.42
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 98.42
2vup_A190 Glutathione peroxidase-like protein; oxidoreductas 98.39
2p31_A181 CL683, glutathione peroxidase 7; thioredoxin fold, 98.38
2p5q_A170 Glutathione peroxidase 5; thioredoxin fold, oxidor 98.38
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 98.35
2v1m_A169 Glutathione peroxidase; selenium, selenocysteine, 98.35
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 98.34
2hyx_A 352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 98.33
2f8a_A208 Glutathione peroxidase 1; thioredoxin fold, struct 98.33
3cmi_A171 Peroxiredoxin HYR1; thioredoxin-like fold, oxidore 98.31
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 98.3
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 98.3
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 98.28
2ls5_A159 Uncharacterized protein; structural genomics, unkn 97.61
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 98.21
3dwv_A187 Glutathione peroxidase-like protein; alpha beta, 3 98.19
4hde_A170 SCO1/SENC family lipoprotein; structural genomics, 98.15
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 98.14
4evm_A138 Thioredoxin family protein; structural genomics, n 98.13
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 98.12
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 98.02
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 98.01
3kij_A180 Probable glutathione peroxidase 8; human PDI-perox 98.0
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 97.82
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 97.74
2lus_A143 Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci 96.88
3s9f_A165 Tryparedoxin; thioredoxin fold, disulfide reductas 97.61
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 97.55
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 97.55
>4h86_A Peroxiredoxin type-2; oxidoreductase; 2.00A {Saccharomyces cerevisiae} PDB: 4dsq_A 4dsr_A 4dss_A Back     alignment and structure
Probab=100.00  E-value=1.8e-36  Score=221.71  Aligned_cols=107  Identities=30%  Similarity=0.575  Sum_probs=97.4

Q ss_pred             CCcchhHHHcHHHH-HhCCCCEEEEEecCCHHHHHHHHHhcCCCC--ceEEeecCCchHhHhhCCccccccCCceeEeEE
Q psy5401           2 KTHLPGYLAKEKDL-KAKGIHEIFCIAVNDAFVMEAWCRKNNAEG--KIRFLADPNLEFTKKLGVEHEIPVLGGWRSKRY   78 (109)
Q Consensus         2 ~~hlp~f~~~~~~f-~~~Gvd~V~~iS~dd~f~~~aW~~~~~~~~--~i~~lsD~~~~~~k~~G~~~~~~~~Gg~r~~R~   78 (109)
                      ++|||+|++++++| +++|+|+|+|||+||||||+||++.++.++  +|+||+|++++|+++||+..+.. .|+.|++||
T Consensus        87 ~~hlPgf~~~~d~~~k~kGvd~I~ciSVND~FVm~AW~k~~~~~~~~~i~~laD~~~eftkalGl~~~~~-~gg~RS~Ry  165 (199)
T 4h86_A           87 VSHIPGYINYLDELVKEKEVDQVIVVTVDNPFANQAWAKSLGVKDTTHIKFASDPGCAFTKSIGFELAVG-DGVYWSGRW  165 (199)
T ss_dssp             HTTHHHHHHHHHHHHHHSCCCEEEEEESSCHHHHHHHHHHTTCCCCSSEEEEECGGGHHHHHTTCEEEEE-TTEEEECSE
T ss_pred             hhhChHHHHHHHHHHHhcCCcEEEEEEcCCHHHHHHHHHHhcccccccccccCCcchHHHHhcCceeecC-CCcceeeEE
Confidence            36999999999986 899999999999999999999999998764  59999999999999999988754 346799999


Q ss_pred             EEEEeCCeEEEEEEecCCC-ceeeeccccccC
Q psy5401          79 SMVVDDGKITQLNIEPDGT-GLTCSLVDELKL  109 (109)
Q Consensus        79 ~fiVddG~V~~~~v~~~~~-~~~~s~a~~vl~  109 (109)
                      +||||||+|+|+++|++|+ ++++|+||+||+
T Consensus       166 a~IVdDGvV~~~~vE~~pg~~~~vS~ae~vL~  197 (199)
T 4h86_A          166 AMVVENGIVTYAAKETNPGTDVTVSSVESVLA  197 (199)
T ss_dssp             EEEEETTEEEEEEECSSTTTCCSTTSHHHHHT
T ss_pred             EEEEECCEEEEEEEeCCCCCCCcccCHHHHHh
Confidence            9999999999999998774 699999999996
>2xhf_A Peroxiredoxin 5; oxidoreductase, antioxidant enzymes; 1.30A {Alvinella pompejana} Back     alignment and structure
>4f82_A Thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>1xiy_A Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin fold, peroxiredoxin fold, oxidoreductase; 1.80A {Plasmodium falciparum} SCOP: c.47.1.10 Back     alignment and structure
>3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} SCOP: c.47.1.10 PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A Back     alignment and structure
>3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} Back     alignment and structure
>3sbc_A Peroxiredoxin TSA1; alpha-beta fold, peroxidase, cytosol, oxidoreductase; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 Back     alignment and structure
>2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} Back     alignment and structure
>3tue_A Tryparedoxin peroxidase; thioredoxin fold, peroxiredoxin, oxidoreductase; 3.00A {Leishmania major} PDB: 1e2y_A Back     alignment and structure
>4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A Back     alignment and structure
>3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, Pro structure initiative; HET: MSE; 1.80A {Chromobacterium violaceum} Back     alignment and structure
>1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 PDB: 3tb2_A Back     alignment and structure
>2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A Back     alignment and structure
>3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C Back     alignment and structure
>1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10 Back     alignment and structure
>3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A Back     alignment and structure
>4eo3_A Bacterioferritin comigratory protein/NADH dehydro; thioredoxin-fold, alpha-beta-aplha sandwich fold, antioxidan oxidoreductase, FMN binding; HET: FMN; 1.65A {Thermotoga maritima} Back     alignment and structure
>3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} Back     alignment and structure
>1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A Back     alignment and structure
>2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} Back     alignment and structure
>3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} Back     alignment and structure
>2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A Back     alignment and structure
>3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A Back     alignment and structure
>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Back     alignment and structure
>1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 Back     alignment and structure
>1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 Back     alignment and structure
>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Back     alignment and structure
>3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0 Back     alignment and structure
>3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A Back     alignment and structure
>1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 Back     alignment and structure
>2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 Back     alignment and structure
>3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D Back     alignment and structure
>1qmv_A Human thioredoxin peroxidase-B; peroxiredoxin, sulphinic acid; 1.7A {Homo sapiens} SCOP: c.47.1.10 PDB: 1qq2_A 2z9s_A 2rii_A 3hy2_A* Back     alignment and structure
>2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Back     alignment and structure
>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A Back     alignment and structure
>1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A Back     alignment and structure
>2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A Back     alignment and structure
>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} Back     alignment and structure
>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A Back     alignment and structure
>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} Back     alignment and structure
>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A Back     alignment and structure
>3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A Back     alignment and structure
>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Back     alignment and structure
>2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} Back     alignment and structure
>2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} Back     alignment and structure
>2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A Back     alignment and structure
>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A Back     alignment and structure
>4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis} Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Back     alignment and structure
>2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} Back     alignment and structure
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 109
d1xiya1179 c.47.1.10 (A:2-180) 1-Cys peroxiredoxin {Malaria p 2e-20
d1hd2a_161 c.47.1.10 (A:) Peroxiredoxin 5 {Human (Homo sapien 4e-15
d1tp9a1162 c.47.1.10 (A:1-162) Plant peroxiredoxin {Western b 3e-14
d1nm3a2163 c.47.1.10 (A:3-165) N-terminal, Prx domain of Hybr 4e-09
d1qxha_164 c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia c 1e-06
d1uula_194 c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxi 0.001
>d1xiya1 c.47.1.10 (A:2-180) 1-Cys peroxiredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 179 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione peroxidase-like
domain: 1-Cys peroxiredoxin
species: Malaria parasite (Plasmodium falciparum) [TaxId: 5833]

 Score = 78.6 bits (193), Expect = 2e-20
 Identities = 23/99 (23%), Positives = 50/99 (50%), Gaps = 3/99 (3%)

Query: 1   MKTHLPGYLAK-EKDLKAKGIHEIFCIAVNDAFVMEAWCRKNNAEGKIRFLADPNLEFTK 59
               +PGY  + +  +K     +I+CI  ND +V+++W +  + + KI++++D N  FT 
Sbjct: 59  STKMIPGYEEEYDYFIKENNFDDIYCITNNDIYVLKSWFKSMDIK-KIKYISDGNSSFTD 117

Query: 60  KLGVEHEIPVLG-GWRSKRYSMVVDDGKITQLNIEPDGT 97
            + +  +      G R  R+  +V++  + ++  E D  
Sbjct: 118 SMNMLVDKSNFFMGMRPWRFVAIVENNILVKMFQEKDKQ 156
>d1hd2a_ c.47.1.10 (A:) Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1tp9a1 c.47.1.10 (A:1-162) Plant peroxiredoxin {Western balsam poplar(Populus trichocarpa) [TaxId: 3694]} Length = 162 Back     information, alignment and structure
>d1nm3a2 c.47.1.10 (A:3-165) N-terminal, Prx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Length = 163 Back     information, alignment and structure
>d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} Length = 164 Back     information, alignment and structure
>d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} Length = 194 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
d1xiya1179 1-Cys peroxiredoxin {Malaria parasite (Plasmodium 100.0
d1tp9a1162 Plant peroxiredoxin {Western balsam poplar(Populus 99.96
d1hd2a_161 Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606 99.96
d1nm3a2163 N-terminal, Prx domain of Hybrid-Prx5 {Haemophilus 99.92
d1n8ja_186 Alkyl hydroperoxide reductase AhpC {Salmonella typ 99.87
d1zyea1158 Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ 99.85
d1we0a1166 Alkyl hydroperoxide reductase AhpC {Amphibacillus 99.84
d1xcca_219 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [Tax 99.84
d2bmxa1169 Alkyl hydroperoxide reductase AhpC {Mycobacterium 99.83
d1uula_194 Tryparedoxin peroxidase (thioredoxin peroxidase ho 99.83
d1zofa1170 Thioredoxin reductase TsaA {Helicobacter pylori [T 99.82
d1qmva_197 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 99.82
d2h01a1170 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 99.82
d1prxa_220 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 99.81
d2zcta1237 Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} 99.79
d1e2ya_167 Tryparedoxin peroxidase (thioredoxin peroxidase ho 99.73
d2cx4a1160 Bacterioferritin comigratory protein {Archaeon Aer 99.71
d1q98a_164 Thiol peroxidase Tpx {Haemophilus influenzae [TaxI 99.7
d2a4va1156 Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c 99.69
d1xvwa1153 Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri 99.69
d1qxha_164 Thiol peroxidase Tpx {Escherichia coli [TaxId: 562 99.64
d1psqa_163 Probable thiol peroxidase PsaD {Streptococcus pneu 99.61
d1xvqa_166 Thiol peroxidase Tpx {Mycobacterium tuberculosis [ 99.56
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 98.9
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 98.48
d2b5xa1143 thiol:disulfide oxidoreductase YkuV {Bacillus subt 98.42
d2fy6a1143 Peptide methionine sulfoxide reductase MsrA/MsrB, 98.36
d1jfua_176 Membrane-anchored thioredoxin-like protein TlpA, s 98.35
d2cvba1187 Probable thiol-disulfide isomerase/thioredoxin TTH 98.34
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 98.28
d1xzoa1172 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 98.2
d1z5ye1136 Thioredoxin-like protein CcmG (CycY, DsbE) {Escher 97.84
d1knga_144 Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr 97.25
d1o73a_144 Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 96.85
d1i5ga_144 Tryparedoxin II {Crithidia fasciculata [TaxId: 565 96.13
d1o8xa_144 Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 95.79
d1wp0a1160 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 94.84
>d1xiya1 c.47.1.10 (A:2-180) 1-Cys peroxiredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione peroxidase-like
domain: 1-Cys peroxiredoxin
species: Malaria parasite (Plasmodium falciparum) [TaxId: 5833]

Probab=100.00  E-value=1.1e-36  Score=218.23  Aligned_cols=107  Identities=24%  Similarity=0.496  Sum_probs=97.8

Q ss_pred             CCcchhHHHcHHHH-HhCCCCEEEEEecCCHHHHHHHHHhcCCCCceEEeecCCchHhHhhCCccccccCC-ceeEeEEE
Q psy5401           2 KTHLPGYLAKEKDL-KAKGIHEIFCIAVNDAFVMEAWCRKNNAEGKIRFLADPNLEFTKKLGVEHEIPVLG-GWRSKRYS   79 (109)
Q Consensus         2 ~~hlp~f~~~~~~f-~~~Gvd~V~~iS~dd~f~~~aW~~~~~~~~~i~~lsD~~~~~~k~~G~~~~~~~~G-g~r~~R~~   79 (109)
                      ++|+|+|++++++| +++|+|+|+|||+||||||+||++.++.. +|.||||++++|+++||+..+.+..| |.||+||+
T Consensus        60 ~~hlp~y~~~~d~f~k~~gvd~I~~iSvnD~fv~~aW~~~~~~~-~I~~lsD~~g~f~k~lg~~~d~~~~g~G~Rs~R~a  138 (179)
T d1xiya1          60 TKMIPGYEEEYDYFIKENNFDDIYCITNNDIYVLKSWFKSMDIK-KIKYISDGNSSFTDSMNMLVDKSNFFMGMRPWRFV  138 (179)
T ss_dssp             HTHHHHHHHTHHHHHTTSCCSEEEEEESSCHHHHHHHHHHTTCC-SSEEEECTTSHHHHHTTCEEECGGGTCCEEECCEE
T ss_pred             hhhCcchhhhHHHHHHhcCCceEEEEecCCHHHHHHHHhhcCcc-eEEEeeCCchHHHHhhhcccccccCCCeeEEeeEE
Confidence            36999999999999 68999999999999999999999999985 49999999999999999998875555 89999999


Q ss_pred             EEEeCCeEEEEEEecCCCc------eeeeccccccC
Q psy5401          80 MVVDDGKITQLNIEPDGTG------LTCSLVDELKL  109 (109)
Q Consensus        80 fiVddG~V~~~~v~~~~~~------~~~s~a~~vl~  109 (109)
                      |||+||+|+++++|+++..      +++|+||+||+
T Consensus       139 ~iiddg~I~~~~vE~~~~~~~~~dp~~vSsae~iL~  174 (179)
T d1xiya1         139 AIVENNILVKMFQEKDKQHNIQTDPYDISTVNNVKE  174 (179)
T ss_dssp             EEEETTEEEEEEECSSCCTTCSSCCCSTTSHHHHHH
T ss_pred             EEEECCEEEEEEEeCCCCCCCCCCCcccCCHHHHHH
Confidence            9999999999999986654      89999999984
>d1tp9a1 c.47.1.10 (A:1-162) Plant peroxiredoxin {Western balsam poplar(Populus trichocarpa) [TaxId: 3694]} Back     information, alignment and structure
>d1hd2a_ c.47.1.10 (A:) Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nm3a2 c.47.1.10 (A:3-165) N-terminal, Prx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} Back     information, alignment and structure
>d1xcca_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1xvqa_ c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure