Diaphorina citri psyllid: psy5451


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------
MSLVMKKNEEREALRGVIQQWNANRLDLFELSEPNDQWNANRLDLFELSEPNDDLLFHGVMRFYFQDSGQKVATKCIRVASDATSQADLLFHGVMRFYFQDSGQKVATKCIRVASDATSQAVIETLIEKFRPDMRMLSVPEYALYEIHENGDERKLGTDEKPLLVQLNWHKDDREGRFLLRRIDEATNVSINHTGTQ
cccHHcHHHHHHHHHHHHHHHcccccccccccccccHHccccccccccccccccccEEEEEEEECcccccEEEEEcccccccccccccccccEEEEEEEEcccccEEEEEEEEcccccHHHHHHHHHHHccccccccccccEEEEEEcccccccccccccccEEEEEcccccccEEEEEEEcccccccccccccccc
*************LRGVIQQWNANRLDLFELSEPNDQWNANRLDLFELSEPNDDLLFHGVMRFYFQDSGQKVATKCIRVASDATSQADLLFHGVMRFYFQDSGQKVATKCIRVASDATSQAVIETLIEKFRPDMRMLSVPEYALYEIHENGDERKLGTDEKPLLVQLNWHKDDREGRFLLRRI**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLVMKKNEEREALRGVIQQWNANRLDLFELSEPNDQWNANRLDLFELSEPNDDLLFHGVMRFYFQDSGQKVATKCIRVASDATSQADLLFHGVMRFYFQDSGQKVATKCIRVASDATSQAVIETLIEKFRPDMRMLSVPEYALYEIHENGDERKLGTDEKPLLVQLNWHKDDREGRFLLRRIDEATNVSINHTGTQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Afadin Belongs to an adhesion system, probably together with the E-cadherin-catenin system, which plays a role in the organization of homotypic, interneuronal and heterotypic cell-cell adherens junctions (AJs). Nectin- and actin-filament-binding protein that connects nectin to the actin cytoskeleton. May play a key role in the organization of epithelial structures of the embryonic ectoderm.confidentO35889
Afadin Belongs to an adhesion system, probably together with the E-cadherin-catenin system, which plays a role in the organization of homotypic, interneuronal and heterotypic cell-cell adherens junctions (AJs). Nectin- and actin-filament-binding protein that connects nectin to the actin cytoskeleton. May play a key role in the organization of epithelial structures of the embryonic ectoderm.confidentQ9QZQ1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005926 [CC]connecting hemi-adherens junctionprobableGO:0070161, GO:0005575, GO:0005912, GO:0005924, GO:0030054, GO:0030055
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0007219 [BP]Notch signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0050839 [MF]cell adhesion molecule bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0048598 [BP]embryonic morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0016318 [BP]ommatidial rotationprobableGO:0048749, GO:0060429, GO:0007163, GO:0007164, GO:0009653, GO:0007275, GO:0044699, GO:0007389, GO:0001745, GO:0008150, GO:0048513, GO:0048729, GO:0032502, GO:0009887, GO:0032501, GO:0002009, GO:0042067, GO:0048592, GO:0009987, GO:0009888, GO:0044767, GO:0001738, GO:0001654, GO:0048731, GO:0001736, GO:0007423, GO:0044707, GO:0048856, GO:0044763
GO:0005915 [CC]zonula adherensprobableGO:0070161, GO:0005575, GO:0005913, GO:0005912, GO:0005911, GO:0043296, GO:0030054
GO:0048730 [BP]epidermis morphogenesisprobableGO:0032502, GO:0009887, GO:0008544, GO:0044707, GO:0032501, GO:0048856, GO:0009888, GO:0044767, GO:0048513, GO:0008150, GO:0048729, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0045177 [CC]apical part of cellprobableGO:0005575, GO:0044464, GO:0005623
GO:0007265 [BP]Ras protein signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0007264, GO:0050789, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DDC, chain B
Confidence level:very confident
Coverage over the Query: 12-30,44-80,96-183
View the alignment between query and template
View the model in PyMOL