Diaphorina citri psyllid: psy5453


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MDCKIKISEDINNIPLADDDPQAIISDEVESSQNSEGPIRADHSLDSISSSFTNSSSSPGRNSLDPDVSPDEQEEKARLISQVLELQNTLDDLSQRVDSVKEENLRLRSENQVLGQYIENLMSASSVFQSTSPKSGKK
ccccccHHccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc
************NIPLAD************************************************************LISQVLELQNTLDDLSQRV**************QVLGQYIENLMS***************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDCKIKISEDINNIPLADDDPQAIISDEVESSQNSEGPIRADHSLDSISSSFTNSSSSPGRNSLDPDVSPDEQEExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNQVLGQYIENLMSASSVFQSTSPKSGKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Short coiled-coil protein confidentQ5RJZ6
Short coiled-coil protein A confidentQ08BG7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0016239 [BP]positive regulation of macroautophagyprobableGO:0032106, GO:0032107, GO:0032104, GO:0032103, GO:0031329, GO:0032101, GO:0009896, GO:0048584, GO:0031323, GO:0009894, GO:0032109, GO:0010647, GO:0010646, GO:0050789, GO:0009893, GO:0019222, GO:0010508, GO:0065007, GO:0048518, GO:0010506, GO:0031325, GO:0016241, GO:0031331, GO:0048583, GO:0050794, GO:0008150, GO:0080134, GO:0080135, GO:0048522
GO:0005802 [CC]trans-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005768 [CC]endosomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0030516 [BP]regulation of axon extensionprobableGO:0022604, GO:0048638, GO:0044707, GO:0051239, GO:0022603, GO:0030154, GO:0051128, GO:0016043, GO:0061387, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0040008, GO:0060284, GO:0090066, GO:0045664, GO:0010769, GO:0065007, GO:0071840, GO:0065008, GO:0031344, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0001558, GO:0044763, GO:0010975, GO:0048731, GO:0022008, GO:0048699, GO:0050770, GO:0007399, GO:0048856, GO:0008361, GO:0051960, GO:2000026, GO:0007275, GO:0008150, GO:0032535
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0000139 [CC]Golgi membraneprobableGO:0005737, GO:0005794, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0012505, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0050807 [BP]regulation of synapse organizationprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050803, GO:0050877, GO:0009987, GO:0044763, GO:0050794, GO:0051128, GO:0065007, GO:0008150, GO:0023052, GO:0007268, GO:0007267, GO:0007154, GO:0065008, GO:0050789, GO:0044699, GO:0003008
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TSO, chain C
Confidence level:probable
Coverage over the Query: 74-97,112-134
View the alignment between query and template
View the model in PyMOL