Diaphorina citri psyllid: psy5454


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MKSELIKSSLLLKNYNGSEITSGSPKRHRLHPNVTEVGSDRASPYGQSQSLQLFGPNIQPRHCVIAHTEGIVTVTPCSREAETFVNGQRIFETTILQVVVAASAVAEKQQQSDNLKEIDNDTTILMIGT
ccEEEEEccccccccccccccccccEEEEcccccEEEcccccccccccccEEECccccccccEEEECcccEEEEEEcccccEEEEccCEccEEEEEcccccccccHHHHHcccccccccccccEEEccc
******KSSLLLKNYNGSEITSGSPKRHRLHPNVTEVGSDRASPYGQSQSLQLFGPNIQPRHCVIAHTEGIVTVTPCSREAETFVNGQRIFETTILQVVVAASAV*****************TILMIG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSELIKSSLLLKNYNGSEITSGSPKRHRLHPNVTEVGSDRASPYGQSQSLQLFGPNIQPRHCVIAHTEGIVTVTPCSREAETFVNGQRIFETTILQVVVAASAVAEKQQQSDNLKEIDNDTTILMIGT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Afadin Belongs to an adhesion system, probably together with the E-cadherin-catenin system, which plays a role in the organization of homotypic, interneuronal and heterotypic cell-cell adherens junctions (AJs). Nectin- and actin-filament-binding protein that connects nectin to the actin cytoskeleton.confidentP55196

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005912 [CC]adherens junctionprobableGO:0005575, GO:0070161, GO:0030054
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0045177 [CC]apical part of cellprobableGO:0005575, GO:0044464, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WLN, chain A
Confidence level:very confident
Coverage over the Query: 2-106
View the alignment between query and template
View the model in PyMOL