Psyllid ID: psy5454

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MKSELIKSSLLLKNYNGSEITSGSPKRHRLHPNVTEVGSDRASPYGQSQSLQLFGPNIQPRHCVIAHTEGIVTVTPCSREAETFVNGQRIFETTILQVVVAASAVAEKQQQSDNLKEIDNDTTILMIGT
ccEEEEEccccccccccccccccccEEEEcccccEEEcccccccccccccEEEEccccccccEEEEEcccEEEEEEcccccEEEEccEEccEEEEEcccccccccHHHHHcccccccccccccEEEccc
cccHHHcHHHHHcccccccccccccEEEEEccccEEEcccccccccccccEEEcccccccccEEEEccccEEEEEEcccccEEEEcccEEcccEEEEEEEHHHHHHHHHHcccccHHcccccEEEEEcc
MKSELIKSSLLlknyngseitsgspkrhrlhpnvtevgsdraspygqsqslqlfgpniqprhcviahtegivtvtpcsreaetfvngqRIFETTILQVVVAASAVAEkqqqsdnlkeidndttilmigt
MKSELIKSSLLLKNYNgseitsgspkrhrlHPNVTEVGSDRASPYGQSQSLQLFGPNIQPRHCVIAHTEGIVTVTPCSREAETFVNGQRIFETTILQVVVAASAVaekqqqsdnlkeidndttilmigt
MkseliksslllkNYNGSEITSGSPKRHRLHPNVTEVGSDRASPYGQSQSLQLFGPNIQPRHCVIAHTEGIVTVTPCSREAETFVNGQRIFETTILQVVVAASAVAEKQQQSDNLKEIDNDTTILMIGT
***************************************************QLFGPNIQPRHCVIAHTEGIVTVTPCSREAETFVNGQRIFETTILQVVVAASAV************************
******KSSLLLKNYNGSEITSGSPKRHRLHPNVTEVGSDRASPYGQSQSLQLFGPNIQPRHCVIAHTEGIVTVTPCSREAETFVNGQRIFETTILQV************************TILMIG*
MKSELIKSSLLLKNYNGSE*********RLHPNVTEVGSDRASPYGQSQSLQLFGPNIQPRHCVIAHTEGIVTVTPCSREAETFVNGQRIFETTILQVVVAASAVAEKQQQSDNLKEIDNDTTILMIGT
***ELIKSSLLLKNYNGSEITSGSPKRHRLHPNVTEVGSDRASPYGQSQSLQLFGPNIQPRHCVIAHTEGIVTVTPCSREAETFVNGQRIFETTILQVVVAASAVAEKQQQSDNLKEIDNDTTILMIGT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSELIKSSLLLKNYNGSEITSGSPKRHRLHPNVTEVGSDRASPYGQSQSLQLFGPNIQPRHCVIAHTEGIVTVTPCSREAETFVNGQRIFETTILQVVVAASAVAEKQQQSDNLKEIDNDTTILMIGT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query129 2.2.26 [Sep-21-2011]
O35889 1829 Afadin OS=Rattus norvegic yes N/A 0.612 0.043 0.493 2e-16
P55196 1824 Afadin OS=Homo sapiens GN yes N/A 0.620 0.043 0.517 2e-16
Q9QZQ1 1820 Afadin OS=Mus musculus GN yes N/A 0.612 0.043 0.493 2e-16
Q7PHR1 1644 Kinesin-like protein unc- no N/A 0.372 0.029 0.387 0.0003
>sp|O35889|AFAD_RAT Afadin OS=Rattus norvegicus GN=Mllt4 PE=1 SV=1 Back     alignment and function desciption
 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 56/83 (67%), Gaps = 4/83 (4%)

Query: 15  YNGSEITSGSPKRHRLHPNVTEVGSDRASPYGQSQSLQLFGPNIQPRHCVIAHTEGIVTV 74
           Y     +   PK +RL  +VTEVG+++        S+QLFGP IQP HC + + +G+VTV
Sbjct: 406 YEDGSDSRDKPKLYRLQLSVTEVGTEKFD----DNSIQLFGPGIQPHHCDLTNMDGVVTV 461

Query: 75  TPCSREAETFVNGQRIFETTILQ 97
           TP S +AET+V+GQRI ETT+LQ
Sbjct: 462 TPRSMDAETYVDGQRISETTMLQ 484
Belongs to an adhesion system, probably together with the E-cadherin-catenin system, which plays a role in the organization of homotypic, interneuronal and heterotypic cell-cell adherens junctions (AJs). Nectin- and actin-filament-binding protein that connects nectin to the actin cytoskeleton. May play a key role in the organization of epithelial structures of the embryonic ectoderm.
Rattus norvegicus (taxid: 10116)
>sp|P55196|AFAD_HUMAN Afadin OS=Homo sapiens GN=MLLT4 PE=1 SV=3 Back     alignment and function description
>sp|Q9QZQ1|AFAD_MOUSE Afadin OS=Mus musculus GN=Mllt4 PE=1 SV=3 Back     alignment and function description
>sp|Q7PHR1|KIF1A_ANOGA Kinesin-like protein unc-104 OS=Anopheles gambiae GN=unc-104 PE=3 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
242025058 1961 afadin, putative [Pediculus humanus corp 0.651 0.042 0.715 6e-29
328715607 1909 PREDICTED: afadin-like [Acyrthosiphon pi 0.666 0.045 0.696 2e-27
345480028 2043 PREDICTED: afadin-like [Nasonia vitripen 0.666 0.042 0.619 8e-23
328792941 2287 PREDICTED: hypothetical protein LOC41016 0.666 0.037 0.630 9e-23
383865464 2805 PREDICTED: uncharacterized protein LOC10 0.666 0.030 0.608 1e-22
307200209 2100 Afadin [Harpegnathos saltator] 0.666 0.040 0.619 2e-22
260823346 1640 hypothetical protein BRAFLDRAFT_208117 [ 0.558 0.043 0.671 2e-21
321471310 1865 hypothetical protein DAPPUDRAFT_316993 [ 0.651 0.045 0.441 2e-18
291225484 2150 PREDICTED: AF6-like protein [Saccoglossu 0.651 0.039 0.494 2e-18
390339868 2212 PREDICTED: afadin [Strongylocentrotus pu 0.674 0.039 0.522 4e-16
>gi|242025058|ref|XP_002432943.1| afadin, putative [Pediculus humanus corporis] gi|212518452|gb|EEB20205.1| afadin, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  132 bits (331), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 63/88 (71%), Positives = 72/88 (81%), Gaps = 4/88 (4%)

Query: 10  LLLKNYNGSEITSGSPKRHRLHPNVTEVGSDRASPYGQSQSLQLFGPNIQPRHCVIAHTE 69
            L  N +GSEI SG+ KRH LHPNVTEVG +R        +LQLFGPNIQPRHCVIAHT+
Sbjct: 434 FLELNPDGSEIMSGTAKRHVLHPNVTEVGLERTG----GPNLQLFGPNIQPRHCVIAHTD 489

Query: 70  GIVTVTPCSREAETFVNGQRIFETTILQ 97
           G+VTVTPCSR+AET+VNGQRI+ETTILQ
Sbjct: 490 GLVTVTPCSRDAETYVNGQRIYETTILQ 517

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328715607|ref|XP_001944877.2| PREDICTED: afadin-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|345480028|ref|XP_001605722.2| PREDICTED: afadin-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|328792941|ref|XP_393645.4| PREDICTED: hypothetical protein LOC410161 [Apis mellifera] Back     alignment and taxonomy information
>gi|383865464|ref|XP_003708193.1| PREDICTED: uncharacterized protein LOC100877377 [Megachile rotundata] Back     alignment and taxonomy information
>gi|307200209|gb|EFN80503.1| Afadin [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|260823346|ref|XP_002604144.1| hypothetical protein BRAFLDRAFT_208117 [Branchiostoma floridae] gi|229289469|gb|EEN60155.1| hypothetical protein BRAFLDRAFT_208117 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|321471310|gb|EFX82283.1| hypothetical protein DAPPUDRAFT_316993 [Daphnia pulex] Back     alignment and taxonomy information
>gi|291225484|ref|XP_002732730.1| PREDICTED: AF6-like protein [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|390339868|ref|XP_794644.3| PREDICTED: afadin [Strongylocentrotus purpuratus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
ZFIN|ZDB-GENE-050419-52 1912 mllt4 "myeloid/lymphoid or mix 0.596 0.040 0.5 2.5e-16
UNIPROTKB|H0Y7R8 389 MLLT4 "Afadin" [Homo sapiens ( 0.596 0.197 0.512 7.7e-16
UNIPROTKB|Q5TIG5 1665 MLLT4 "Afadin" [Homo sapiens ( 0.620 0.048 0.517 9.6e-16
UNIPROTKB|A8MQ02 1824 MLLT4 "Afadin" [Homo sapiens ( 0.620 0.043 0.517 1.2e-15
UNIPROTKB|P55196 1824 MLLT4 "Afadin" [Homo sapiens ( 0.620 0.043 0.517 1.2e-15
UNIPROTKB|J3KN01 1831 MLLT4 "Afadin" [Homo sapiens ( 0.620 0.043 0.517 1.2e-15
UNIPROTKB|C9JX92 1743 MLLT4 "Afadin" [Homo sapiens ( 0.596 0.044 0.512 1.4e-15
MGI|MGI:1314653 1820 Mllt4 "myeloid/lymphoid or mix 0.596 0.042 0.512 1.9e-15
RGD|708561 1829 Mllt4 "myeloid/lymphoid or mix 0.596 0.042 0.512 1.9e-15
UNIPROTKB|E1C5E4 1835 MLLT4 "Uncharacterized protein 0.620 0.043 0.505 4e-15
ZFIN|ZDB-GENE-050419-52 mllt4 "myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 210 (79.0 bits), Expect = 2.5e-16, Sum P(2) = 2.5e-16
 Identities = 41/82 (50%), Positives = 60/82 (73%)

Query:    16 NGSEITSGSPKRHRLHPNVTEVGSDRASPYGQSQSLQLFGPNIQPRHCVIAHTEGIVTVT 75
             +GS+ +   PK +RL  +VTEVGSDR+    +  ++QLFGP I P HC + H +G+VT+T
Sbjct:   389 DGSD-SRDKPKLYRLQHSVTEVGSDRS----EDGNIQLFGPGILPHHCDLMHADGLVTIT 443

Query:    76 PCSREAETFVNGQRIFETTILQ 97
             P + +AETFV+GQRI +TT+L+
Sbjct:   444 PANMDAETFVDGQRIADTTVLR 465
GO:0007165 "signal transduction" evidence=IEA
UNIPROTKB|H0Y7R8 MLLT4 "Afadin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5TIG5 MLLT4 "Afadin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A8MQ02 MLLT4 "Afadin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P55196 MLLT4 "Afadin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3KN01 MLLT4 "Afadin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|C9JX92 MLLT4 "Afadin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1314653 Mllt4 "myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|708561 Mllt4 "myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1C5E4 MLLT4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P55196AFAD_HUMANNo assigned EC number0.51720.62010.0438yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
smart0024052 smart00240, FHA, Forkhead associated domain 2e-06
pfam0049867 pfam00498, FHA, FHA domain 1e-05
cd00060102 cd00060, FHA, Forkhead associated domain (FHA); fo 1e-04
>gnl|CDD|214578 smart00240, FHA, Forkhead associated domain Back     alignment and domain information 
 Score = 41.4 bits (98), Expect = 2e-06
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 47 QSQSLQLFGPNIQPRHCVIAHTEG-IVTVTPCSREAETFVNGQRI 90
          +   +QL GP+I  RH VI +  G    +        TFVNG+RI
Sbjct: 8  EDCDIQLDGPSISRRHAVIVYDGGGRFYLIDLGSTNGTFVNGKRI 52

Found in eukaryotic and prokaryotic proteins. Putative nuclear signalling domain. Length = 52
>gnl|CDD|215951 pfam00498, FHA, FHA domain Back     alignment and domain information
>gnl|CDD|238017 cd00060, FHA, Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 129
KOG0245|consensus 1221 99.9
PF0049868 FHA: FHA domain; InterPro: IPR000253 The forkhead- 99.64
KOG1892|consensus 1629 99.6
KOG0241|consensus 1714 99.57
cd00060102 FHA Forkhead associated domain (FHA); found in euk 99.45
TIGR03354 396 VI_FHA type VI secretion system FHA domain protein 99.35
COG1716191 FOG: FHA domain [Signal transduction mechanisms] 99.23
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 99.15
COG3456 430 Predicted component of the type VI protein secreti 99.11
smart0024052 FHA Forkhead associated domain. Found in eukaryoti 99.09
KOG1882|consensus293 97.63
TIGR02500 410 type_III_yscD type III secretion apparatus protein 97.37
KOG0615|consensus 475 96.53
KOG2293|consensus547 96.28
KOG1881|consensus 793 95.5
KOG1880|consensus 337 94.58
PRK0177795 hypothetical protein; Validated 94.16
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 93.98
TIGR0298859 YaaA_near_RecF S4 domain protein YaaA. This small 93.55
cd0016570 S4 S4/Hsp/ tRNA synthetase RNA-binding domain; The 92.86
smart0036360 S4 S4 RNA-binding domain. 92.56
PF1445181 Ub-Mut7C: Mut7-C ubiquitin 92.16
PRK0643767 hypothetical protein; Provisional 92.14
cd0075480 MoaD Ubiquitin domain of MoaD-like proteins. MoaD 91.79
COG250173 S4-like RNA binding protein [Replication, recombin 91.29
cd0056565 ThiS ThiaminS ubiquitin-like sulfur carrier protei 90.83
PF0147948 S4: S4 domain; InterPro: IPR002942 Ribosomes are t 90.44
PRK1150770 ribosome-associated protein; Provisional 88.79
PRK0836470 sulfur carrier protein ThiS; Provisional 88.75
PF0259777 ThiS: ThiS family; InterPro: IPR003749 ThiS (thiam 86.9
COG210468 ThiS Sulfur transfer protein involved in thiamine 85.98
PRK0648865 sulfur carrier protein ThiS; Validated 85.62
TIGR0168364 thiS thiamine biosynthesis protein ThiS. This mode 85.19
TIGR0168280 moaD molybdopterin converting factor, subunit 1, n 84.98
PRK0694465 sulfur carrier protein ThiS; Provisional 84.92
PRK0565966 sulfur carrier protein ThiS; Validated 84.7
PLN0279982 Molybdopterin synthase sulfur carrier subunit 84.53
TIGR0168788 moaD_arch MoaD family protein, archaeal. Members o 84.53
PF1327565 S4_2: S4 domain; PDB: 1P9K_A. 83.63
COG0564 289 RluA Pseudouridylate synthases, 23S RNA-specific [ 83.33
COG1188100 Ribosome-associated heat shock protein implicated 82.81
PRK0744070 hypothetical protein; Provisional 81.33
PRK0769667 sulfur carrier protein ThiS; Provisional 81.17
PRK15367 395 type III secretion system protein SsaD; Provisiona 81.07
cd0166675 TGS_DRG_C TGS_DRG_C: DRG (developmentally regulate 81.03
cd0176494 Urm1 Urm1-like ubuitin domain. Urm1 (Ubiquitin-Rel 80.87
PF1447868 DUF4430: Domain of unknown function (DUF4430); PDB 80.22
>KOG0245|consensus Back     alignment and domain information 
Probab=99.90  E-value=4.4e-24  Score=190.86  Aligned_cols=96  Identities=28%  Similarity=0.316  Sum_probs=90.4

Q ss_pred             CCceeEEEEecCCCCCCCCCCcEEEEcCCCceEEcCCCCCCCCCcccEEEcCCCCCCCcEEEEEcCCE--EEEEeCCCCC
Q psy5454           4 ELIKSSLLLKNYNGSEITSGSPKRHRLHPNVTEVGSDRASPYGQSQSLQLFGPNIQPRHCVIAHTEGI--VTVTPCSREA   81 (129)
Q Consensus         4 ~~~~PhLvnln~dp~ls~~~~~~~~~L~~~~t~IGr~~~~~~~~~~dI~L~g~~I~~~Hc~I~~~~g~--v~L~p~ss~~   81 (129)
                      .++.|||||||+||++|  + |++|+|+.|.|.|||.++   ++.+||+|+|..|..+||.|.+.+|.  |+|.|+ +++
T Consensus       451 ~kk~phLVNLneDPllS--e-~LlY~ikeG~TrVG~~~a---~~~~DI~LsG~~I~~qHC~i~~~~g~~~vtl~p~-e~a  523 (1221)
T KOG0245|consen  451 GKKTPHLVNLNEDPLLS--E-CLLYYIKEGETRVGREDA---SSRQDIVLSGQLIREQHCSIRNEGGNDVVTLEPC-EDA  523 (1221)
T ss_pred             CccCcceeccCCCchhh--c-cEEEEeccCceecCCCCc---ccCCceEecchhhhhhceEEEecCCCceEEeccC-Ccc
Confidence            35899999999999999  9 999999999999999986   46799999999999999999998776  999998 799


Q ss_pred             ceEEcCEEcceeEEcCCCCEEEEec
Q psy5454          82 ETFVNGQRIFETTILQVVVAASAVA  106 (129)
Q Consensus        82 ~t~VNG~~I~~~~~L~~GDrI~~~~  106 (129)
                      .|||||++|.+++.|+|||||.+|-
T Consensus       524 etyVNGk~v~ep~qL~~GdRiilG~  548 (1221)
T KOG0245|consen  524 ETYVNGKLVTEPTQLRSGDRIILGG  548 (1221)
T ss_pred             ceeEccEEcCCcceeccCCEEEEcC
Confidence            9999999999999999999999987

>PF00498 FHA: FHA domain; InterPro: IPR000253 The forkhead-associated (FHA) domain [] is a phosphopeptide recognition domain found in many regulatory proteins Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>KOG0241|consensus Back     alignment and domain information
>cd00060 FHA Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins Back     alignment and domain information
>TIGR03354 VI_FHA type VI secretion system FHA domain protein Back     alignment and domain information
>COG1716 FOG: FHA domain [Signal transduction mechanisms] Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>COG3456 Predicted component of the type VI protein secretion system, contains a FHA domain [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>smart00240 FHA Forkhead associated domain Back     alignment and domain information
>KOG1882|consensus Back     alignment and domain information
>TIGR02500 type_III_yscD type III secretion apparatus protein, YscD/HrpQ family Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>KOG2293|consensus Back     alignment and domain information
>KOG1881|consensus Back     alignment and domain information
>KOG1880|consensus Back     alignment and domain information
>PRK01777 hypothetical protein; Validated Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>TIGR02988 YaaA_near_RecF S4 domain protein YaaA Back     alignment and domain information
>cd00165 S4 S4/Hsp/ tRNA synthetase RNA-binding domain; The domain surface is populated by conserved, charged residues that define a likely RNA-binding site; Found in stress proteins, ribosomal proteins and tRNA synthetases; This may imply a hitherto unrecognized functional similarity between these three protein classes Back     alignment and domain information
>smart00363 S4 S4 RNA-binding domain Back     alignment and domain information
>PF14451 Ub-Mut7C: Mut7-C ubiquitin Back     alignment and domain information
>PRK06437 hypothetical protein; Provisional Back     alignment and domain information
>cd00754 MoaD Ubiquitin domain of MoaD-like proteins Back     alignment and domain information
>COG2501 S4-like RNA binding protein [Replication, recombination, and repair] Back     alignment and domain information
>cd00565 ThiS ThiaminS ubiquitin-like sulfur carrier protein Back     alignment and domain information
>PF01479 S4: S4 domain; InterPro: IPR002942 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK11507 ribosome-associated protein; Provisional Back     alignment and domain information
>PRK08364 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PF02597 ThiS: ThiS family; InterPro: IPR003749 ThiS (thiaminS) is a 66 aa protein involved in sulphur transfer Back     alignment and domain information
>COG2104 ThiS Sulfur transfer protein involved in thiamine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK06488 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>TIGR01683 thiS thiamine biosynthesis protein ThiS Back     alignment and domain information
>TIGR01682 moaD molybdopterin converting factor, subunit 1, non-archaeal Back     alignment and domain information
>PRK06944 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK05659 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>PLN02799 Molybdopterin synthase sulfur carrier subunit Back     alignment and domain information
>TIGR01687 moaD_arch MoaD family protein, archaeal Back     alignment and domain information
>PF13275 S4_2: S4 domain; PDB: 1P9K_A Back     alignment and domain information
>COG0564 RluA Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1188 Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07440 hypothetical protein; Provisional Back     alignment and domain information
>PRK07696 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK15367 type III secretion system protein SsaD; Provisional Back     alignment and domain information
>cd01666 TGS_DRG_C TGS_DRG_C: DRG (developmentally regulated GTP-binding protein) represents a family of GTP-binding proteins that includes two members, DRG1 and DRG2 Back     alignment and domain information
>cd01764 Urm1 Urm1-like ubuitin domain Back     alignment and domain information
>PF14478 DUF4430: Domain of unknown function (DUF4430); PDB: 3U7Z_B 2BB5_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
1wln_A120 Solution Structure Of The Fha Domain Of Mouse Afadi 3e-17
>pdb|1WLN|A Chain A, Solution Structure Of The Fha Domain Of Mouse Afadin 6 Length = 120 Back     alignment and structure 
Iteration: 1

 Score = 83.2 bits (204), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/73 (54%), Positives = 54/73 (73%), Gaps = 4/73 (5%)
Query: 25 PKRHRLHPNVTEVGSDRASPYGQSQSLQLFGPNIQPRHCVIAHTEGIVTVTPCSREAETF 84
          PK +RL  +VTEVG+++        S+QLFGP IQP HC + + +G+VTVTP S +AET+
Sbjct: 28 PKLYRLQLSVTEVGTEKF----DDNSIQLFGPGIQPHHCDLTNMDGVVTVTPRSMDAETY 83
Query: 85 VNGQRIFETTILQ 97
          V+GQRI ETT+LQ
Sbjct: 84 VDGQRISETTMLQ 96

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
1wln_A120 Afadin; beta sandwich, FHA domain, structural geno 2e-20
3fm8_A124 Kinesin-like protein KIF13B; kinesin, GAP, GTPase 4e-09
2eh0_A130 KLP, kinesin-like protein KIF1B; FHA domain, KIAA0 5e-09
2g1l_A104 Kinesin-like protein KIF1C; transport, FHA domain, 4e-08
>1wln_A Afadin; beta sandwich, FHA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.26.1.2 Length = 120 Back     alignment and structure
 Score = 79.2 bits (195), Expect = 2e-20
 Identities = 40/77 (51%), Positives = 55/77 (71%), Gaps = 4/77 (5%)

Query: 21 TSGSPKRHRLHPNVTEVGSDRASPYGQSQSLQLFGPNIQPRHCVIAHTEGIVTVTPCSRE 80
          +   PK +RL  +VTEVG+++        S+QLFGP IQP HC + + +G+VTVTP S +
Sbjct: 24 SRDKPKLYRLQLSVTEVGTEKFDD----NSIQLFGPGIQPHHCDLTNMDGVVTVTPRSMD 79

Query: 81 AETFVNGQRIFETTILQ 97
          AET+V+GQRI ETT+LQ
Sbjct: 80 AETYVDGQRISETTMLQ 96
>3fm8_A Kinesin-like protein KIF13B; kinesin, GAP, GTPase activation, structural genomics consort ATP-binding, cytoskeleton, microtubule, motor protein, NUCL binding; 2.30A {Homo sapiens} PDB: 3mdb_A* Length = 124 Back     alignment and structure
>2eh0_A KLP, kinesin-like protein KIF1B; FHA domain, KIAA0591, KIAA1448, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 130 Back     alignment and structure
>2g1l_A Kinesin-like protein KIF1C; transport, FHA domain, structural genomics consortium, kines transport protein; 2.60A {Homo sapiens} SCOP: b.26.1.2 Length = 104 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
4egx_A184 Kinesin-like protein KIF1A; FHA domain, transport 99.97
3fm8_A124 Kinesin-like protein KIF13B; kinesin, GAP, GTPase 99.96
4ejq_A154 Kinesin-like protein KIF1A; homodimer, FHA domain, 99.96
1wln_A120 Afadin; beta sandwich, FHA domain, structural geno 99.9
1r21_A128 Antigen KI-67; beta sandwich, cell cycle; NMR {Hom 99.73
2xt9_B115 Putative signal transduction protein GARA; lyase-s 99.7
3po8_A100 RV0020C protein, putative uncharacterized protein 99.69
3gqs_A106 Adenylate cyclase-like protein; FHA domain, struct 99.68
2kb3_A143 Oxoglutarate dehydrogenase inhibitor; forkhead-ass 99.67
2jqj_A151 DNA damage response protein kinase DUN1; protein/p 99.66
1uht_A118 Expressed protein; FHA domain, beta-sandwich, anti 99.66
2kfu_A162 RV1827 PThr 22; FHA domain, phosphorylation, intra 99.66
3va4_A132 Mediator of DNA damage checkpoint protein 1; cell 99.63
1lgp_A116 Cell cycle checkpoint protein CHFR; FHA, tungstate 99.63
4h87_A130 Kanadaptin; FHA domain of PF00498, mRNA processing 99.62
1mzk_A139 Kinase associated protein phosphatase; beta sandwi 99.61
3hx1_A131 SLR1951 protein; P74513_SYNY3, adenylate cyclase-l 99.61
3oun_A157 Putative uncharacterized protein TB39.8; peptidogl 99.61
1gxc_A149 CHK2, CDS1, serine/threonine-protein kinase CHK2; 99.59
2pie_A138 E3 ubiquitin-protein ligase RNF8; FHA domain, comp 99.59
1dmz_A158 Protein (protein kinase SPK1); beta-sandwich, anti 99.58
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 99.58
1qu5_A182 Protein kinase SPK1; FHA, RAD53, transferase; NMR 99.57
1g3g_A164 Protien kinase SPK1; FHA domain, RAD53, phosphopep 99.57
1g6g_A127 Protein kinase RAD53; beta-sandwich, phosphopeptid 99.55
2jpe_A140 Nuclear inhibitor of protein phosphatase 1; FHA do 99.55
2csw_A145 Ubiquitin ligase protein RNF8; 11-stranded beta sa 99.54
3els_A158 PRE-mRNA leakage protein 1; intrinsically unstruct 99.48
3elv_A205 PRE-mRNA leakage protein 1; intrinsically unstruct 99.43
3huf_A 325 DNA repair and telomere maintenance protein NBS1; 99.18
4a0e_A123 YSCD, type III secretion protein; transport protei 99.05
3kt9_A102 Aprataxin; FHA domain, beta sandwich, beta sheet, 99.02
3uv0_A102 Mutator 2, isoform B; FHA, protein binding, dimeri 98.93
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 98.9
2brf_A110 Bifunctional polynucleotide phosphatase/kinase; hy 98.81
1wv3_A238 Similar to DNA segregation ATPase and related prot 98.71
1yj5_C143 5' polynucleotide kinase-3' phosphatase FHA domai; 98.64
1ujx_A119 Polynucleotide kinase 3'-phosphatase; DNA repair, 98.48
2q5w_D77 Molybdopterin converting factor, subunit 1; MOCO, 91.82
2hj1_A97 Hypothetical protein; structural genomics, PSI, pr 91.76
3po0_A89 Small archaeal modifier protein 1; ubiquitin-like 90.63
2cu3_A64 Unknown function protein; thermus thermophilus HB8 90.3
1fm0_D81 Molybdopterin convertin factor, subunit 1; molybde 89.43
1rws_A77 Hypothetical protein PF1061; residual dipolar coup 88.15
1f0z_A66 THis protein; ubiquitin fold, transport protein; N 88.1
1vjk_A98 Molybdopterin converting factor, subunit 1; struct 88.07
2k6p_A92 Uncharacterized protein HP_1423; alpha-L motif, RN 87.61
1ryj_A70 Unknown; beta/alpha protein, structural genomics, 87.48
2kl0_A73 Putative thiamin biosynthesis THis; structural gen 86.98
2k5p_A78 THis protein, thiamine-biosynthesis protein; NESG, 86.84
3hvz_A78 Uncharacterized protein; alpha-beta protein, struc 85.94
1tyg_B87 YJBS; alpha beta barrel, protein-protein complex, 85.94
3dwg_C93 9.5 kDa culture filtrate antigen CFP10A; sulfur ca 84.72
1dm9_A133 Hypothetical 15.5 KD protein in MRCA-PCKA intergen 83.2
2l52_A99 Methanosarcina acetivorans SAMP1 homolog; beta-grA 81.86
2g1e_A90 Hypothetical protein TA0895; MOAD, molybdopterin, 81.13
3rpf_C74 Molybdopterin converting factor, subunit 1 (MOAD); 80.52
>4egx_A Kinesin-like protein KIF1A; FHA domain, transport protein; 2.51A {Homo sapiens} Back     alignment and structure
Probab=99.97  E-value=2.4e-30  Score=195.21  Aligned_cols=99  Identities=26%  Similarity=0.343  Sum_probs=89.9

Q ss_pred             CcCCceeEEEEecCCCCCCCCCCcEEEEcCCCceEEcCCCCCCCCCcccEEEcCCCCCCCcEEEEEc-----CCEEEEEe
Q psy5454           2 KSELIKSSLLLKNYNGSEITSGSPKRHRLHPNVTEVGSDRASPYGQSQSLQLFGPNIQPRHCVIAHT-----EGIVTVTP   76 (129)
Q Consensus         2 ~~~~~~PhLvnln~dp~ls~~~~~~~~~L~~~~t~IGr~~~~~~~~~~dI~L~g~~I~~~Hc~I~~~-----~g~v~L~p   76 (129)
                      +.++..|||+|||+||+++  + +++|+|++|.|+|||.++   ...+||+|+|++|+++||.|.+.     .+.|+|+|
T Consensus        63 ~~~~~~PhLvnLn~Dp~ls--~-~l~y~L~~g~t~VGr~~~---~~~~dI~L~G~~I~~~Hc~i~~~~~~~~~~~vtl~p  136 (184)
T 4egx_A           63 FSPKKTPHLVNLNEDPLMS--E-CLLYYIKDGITRVGREDG---ERRQDIVLSGHFIKEEHCVFRSDSRGGSEAVVTLEP  136 (184)
T ss_dssp             ECCSSSCEEEECCCCTTCS--S-CSEEECCSEEEEEECSSS---SSCCSEECCSTTCCSEEEEEEEECCSSCSCEEEEEE
T ss_pred             ecCCCCceEEeccCCcccC--c-eEEEEECCCcCcCCCCCc---CCCCeEEECccccccccEEEEEcCCCCceEEEEEee
Confidence            3567899999999999999  9 999999999999999864   24689999999999999999985     36799999


Q ss_pred             CCCCCceEEcCEEcceeEEcCCCCEEEEecC
Q psy5454          77 CSREAETFVNGQRIFETTILQVVVAASAVAE  107 (129)
Q Consensus        77 ~ss~~~t~VNG~~I~~~~~L~~GDrI~~~~~  107 (129)
                      + +++.|||||++|.+++.|+|||||.||..
T Consensus       137 ~-~~a~t~VNG~~I~~~~~L~~GDrI~lG~~  166 (184)
T 4egx_A          137 C-EGADTYVNGKKVTEPSILRSGNRIIMGKS  166 (184)
T ss_dssp             C-TTCCEEETTEECCSCEECCTTCEEEETTT
T ss_pred             C-CCCeEEEcCEEccccEEcCCCCEEEECCC
Confidence            9 68999999999999999999999999873
>3fm8_A Kinesin-like protein KIF13B; kinesin, GAP, GTPase activation, structural genomics consort ATP-binding, cytoskeleton, microtubule, motor protein, NUCL binding; 2.30A {Homo sapiens} PDB: 3mdb_A* Back     alignment and structure
>4ejq_A Kinesin-like protein KIF1A; homodimer, FHA domain, transport protein; 1.89A {Homo sapiens} PDB: 2eh0_A 2g1l_A Back     alignment and structure
>1wln_A Afadin; beta sandwich, FHA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.26.1.2 Back     alignment and structure
>1r21_A Antigen KI-67; beta sandwich, cell cycle; NMR {Homo sapiens} SCOP: b.26.1.2 PDB: 2aff_A* Back     alignment and structure
>2xt9_B Putative signal transduction protein GARA; lyase-signaling protein complex, KDH, KGD; HET: TPP; 2.20A {Mycobacterium smegmatis} Back     alignment and structure
>3po8_A RV0020C protein, putative uncharacterized protein TB39.8; FHA domain, synthetic peptide, peptide binding protein; 1.50A {Mycobacterium tuberculosis} SCOP: b.26.1.0 PDB: 3poa_A* 2lc1_A Back     alignment and structure
>3gqs_A Adenylate cyclase-like protein; FHA domain, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.20A {Chlamydia trachomatis} Back     alignment and structure
>2kb3_A Oxoglutarate dehydrogenase inhibitor; forkhead-associated domain, kinase substrate, GARA, FHA, cytoplasm, phosphoprotein; HET: TPO; NMR {Corynebacterium glutamicum} PDB: 2kb4_A Back     alignment and structure
>2jqj_A DNA damage response protein kinase DUN1; protein/phosphopeptide, cell cycle; HET: DNA; NMR {Saccharomyces cerevisiae} PDB: 2jql_A* Back     alignment and structure
>1uht_A Expressed protein; FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.26.1.2 Back     alignment and structure
>2kfu_A RV1827 PThr 22; FHA domain, phosphorylation, intramolecular interaction, glutamate metabolism, phosphoprotein, protein binding; HET: TPO; NMR {Mycobacterium tuberculosis} PDB: 2kkl_A Back     alignment and structure
>3va4_A Mediator of DNA damage checkpoint protein 1; cell cycle, FHA domain, DNA-damage, CHK2 and MDC1 dimerizati; HET: TPO; 1.54A {Mus musculus} PDB: 3va1_A* 3umz_A 3unm_A 3unn_A* 3uot_A* 3un0_B Back     alignment and structure
>1lgp_A Cell cycle checkpoint protein CHFR; FHA, tungstate, domain swapping; 2.00A {Homo sapiens} SCOP: b.26.1.2 PDB: 1lgq_A Back     alignment and structure
>4h87_A Kanadaptin; FHA domain of PF00498, mRNA processing, nucleus, structural joint center for structural genomics, JCSG, protein structu initiative; HET: SO4; 1.55A {Homo sapiens} Back     alignment and structure
>3hx1_A SLR1951 protein; P74513_SYNY3, adenylate cyclase-like protein, NESG, structural genomics, PSI-2, protein structure initiative; 2.50A {Synechocystis SP} Back     alignment and structure
>3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Back     alignment and structure
>1gxc_A CHK2, CDS1, serine/threonine-protein kinase CHK2; phosphoprotein-binding domain, checkpoint kinase, transferase; HET: TPO; 2.7A {Homo sapiens} SCOP: b.26.1.2 Back     alignment and structure
>2pie_A E3 ubiquitin-protein ligase RNF8; FHA domain, complex, ligase, signaling protein; HET: TPO; 1.35A {Homo sapiens} SCOP: b.26.1.2 Back     alignment and structure
>1dmz_A Protein (protein kinase SPK1); beta-sandwich, antiparallel beta-sheets, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1fhq_A 1fhr_A* 1j4k_A* 1j4l_A* 1k2m_A* 1k2n_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1qu5_A Protein kinase SPK1; FHA, RAD53, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 Back     alignment and structure
>1g3g_A Protien kinase SPK1; FHA domain, RAD53, phosphopeptide, phosphoprotein, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1j4o_A 1j4p_A* 1j4q_A* 1k3j_A 1k3n_A* 1k3q_A* 2a0t_A* 2jqi_A* Back     alignment and structure
>1g6g_A Protein kinase RAD53; beta-sandwich, phosphopeptide complex, cell cycle; HET: TPO; 1.60A {Saccharomyces cerevisiae} SCOP: b.26.1.2 Back     alignment and structure
>2jpe_A Nuclear inhibitor of protein phosphatase 1; FHA domain, NIPP1, mRNA splicing, transcription; NMR {Mus musculus} Back     alignment and structure
>2csw_A Ubiquitin ligase protein RNF8; 11-stranded beta sandwich, ring finger protein 8, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.26.1.2 Back     alignment and structure
>3els_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3elv_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 2.40A {Saccharomyces cerevisiae} PDB: 2jkd_A Back     alignment and structure
>3huf_A DNA repair and telomere maintenance protein NBS1; NBS1, FHA domain, BRCT domain, phosphoprotein binding, phosp binding, DNA repair; HET: DNA TPO; 2.15A {Schizosaccharomyces pombe} PDB: 3hue_A* 3i0m_A* 3i0n_A* Back     alignment and structure
>4a0e_A YSCD, type III secretion protein; transport protein, SAD phasing, type III secretion system; 2.04A {Yersinia pestis} PDB: 4d9v_A Back     alignment and structure
>3kt9_A Aprataxin; FHA domain, beta sandwich, beta sheet, AMP hydrolase, alternative splicing, disease mutation, DNA damage, DNA repair, DNA-binding; 1.65A {Homo sapiens} SCOP: b.26.1.0 Back     alignment and structure
>3uv0_A Mutator 2, isoform B; FHA, protein binding, dimerization; 1.90A {Drosophila melanogaster} Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>2brf_A Bifunctional polynucleotide phosphatase/kinase; hydrolase/transferase, FHA, forkhead-associated, PNKP, PNK, polynucleotide kinase 3' phosphatase; 1.40A {Homo sapiens} SCOP: b.26.1.2 PDB: 2w3o_A* 1yjm_A* Back     alignment and structure
>1wv3_A Similar to DNA segregation ATPase and related proteins; structural genomics, unknown function; 1.75A {Staphylococcus aureus subsp} SCOP: b.26.1.4 b.26.1.4 Back     alignment and structure
>1yj5_C 5' polynucleotide kinase-3' phosphatase FHA domai; beta sandwich, P-loop, transferase; 2.80A {Mus musculus} SCOP: b.26.1.2 Back     alignment and structure
>1ujx_A Polynucleotide kinase 3'-phosphatase; DNA repair, FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif; NMR {Mus musculus} SCOP: b.26.1.2 Back     alignment and structure
>2q5w_D Molybdopterin converting factor, subunit 1; MOCO, MPT synthase, MOAD, MOAE, transferase, molybdenum cofactor biosynthesis; 2.00A {Staphylococcus aureus} PDB: 2qie_B* Back     alignment and structure
>2hj1_A Hypothetical protein; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; 2.10A {Haemophilus influenzae} SCOP: d.15.3.4 Back     alignment and structure
>3po0_A Small archaeal modifier protein 1; ubiquitin-like protein, protein binding; 1.55A {Haloferax volcanii} PDB: 2l83_A Back     alignment and structure
>2cu3_A Unknown function protein; thermus thermophilus HB8, structural genomics, riken structu genomics/proteomics initiative, RSGI, NPPSFA; 1.70A {Thermus thermophilus} SCOP: d.15.3.2 PDB: 2htm_E Back     alignment and structure
>1fm0_D Molybdopterin convertin factor, subunit 1; molybdenum cofactor biosynthesis, transferase; 1.45A {Escherichia coli} SCOP: d.15.3.1 PDB: 1fma_D 1jw9_D 1jwa_D* 1jwb_D* 3bii_D 1nvi_D Back     alignment and structure
>1rws_A Hypothetical protein PF1061; residual dipolar couplings, structural genomics, unknown FUN; NMR {Pyrococcus furiosus} SCOP: d.15.3.2 PDB: 1sf0_A Back     alignment and structure
>1f0z_A THis protein; ubiquitin fold, transport protein; NMR {Escherichia coli} SCOP: d.15.3.2 PDB: 1zud_2 Back     alignment and structure
>1vjk_A Molybdopterin converting factor, subunit 1; structural genomics, PSI, protein structure INI southeast collaboratory for structural genomics; 1.51A {Pyrococcus furiosus} SCOP: d.15.3.1 Back     alignment and structure
>2k6p_A Uncharacterized protein HP_1423; alpha-L motif, RNA-binding, unknown function; NMR {Helicobacter pylori} Back     alignment and structure
>1ryj_A Unknown; beta/alpha protein, structural genomics, protein structure initiative, OCSP, NESG, PSI; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.15.3.2 Back     alignment and structure
>2k5p_A THis protein, thiamine-biosynthesis protein; NESG, GMR137, structural genomics, PSI-2, protein structure initiative; NMR {Geobacter metallireducens gs-15} PDB: 3cwi_A Back     alignment and structure
>3hvz_A Uncharacterized protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; 2.20A {Clostridium leptum} Back     alignment and structure
>1tyg_B YJBS; alpha beta barrel, protein-protein complex, THis, BIOS protein; 3.15A {Bacillus subtilis} SCOP: d.15.3.2 Back     alignment and structure
>3dwg_C 9.5 kDa culture filtrate antigen CFP10A; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3dwm_A Back     alignment and structure
>1dm9_A Hypothetical 15.5 KD protein in MRCA-PCKA intergenic region; heat shock proteins, protein-RNA interactions, ribosome, structural genomics; 2.00A {Escherichia coli} SCOP: d.66.1.3 PDB: 3bbu_A Back     alignment and structure
>2l52_A Methanosarcina acetivorans SAMP1 homolog; beta-grAsp fold, protein binding, E1-like, SAMP activator, ELSA, adenylation, ubiquitin; NMR {Methanosarcina acetivorans} Back     alignment and structure
>2g1e_A Hypothetical protein TA0895; MOAD, molybdopterin, transferase; NMR {Thermoplasma acidophilum} PDB: 2k22_A Back     alignment and structure
>3rpf_C Molybdopterin converting factor, subunit 1 (MOAD); MCSG, PSI-biology, structural genomics, midwest center for S genomics, transferase; 1.90A {Helicobacter pylori} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 129
d1wlna1107 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [T 7e-12
d2g1la1102 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {H 2e-04
d2affa198 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapi 9e-04
d2ff4a399 b.26.1.2 (A:284-382) Probable regulatory protein E 0.003
>d1wlna1 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 Back     information, alignment and structure

class: All beta proteins
fold: SMAD/FHA domain
superfamily: SMAD/FHA domain
family: FHA domain
domain: Afadin
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 55.8 bits (134), Expect = 7e-12
 Identities = 43/88 (48%), Positives = 62/88 (70%), Gaps = 5/88 (5%)

Query: 10 LLLKNYNGSEITSGSPKRHRLHPNVTEVGSDRASPYGQSQSLQLFGPNIQPRHCVIAHTE 69
          L+  + +GS+ +   PK +RL  +VTEVG+++        S+QLFGP IQP HC + + +
Sbjct: 7  LVELSPDGSD-SRDKPKLYRLQLSVTEVGTEKFDD----NSIQLFGPGIQPHHCDLTNMD 61

Query: 70 GIVTVTPCSREAETFVNGQRIFETTILQ 97
          G+VTVTP S +AET+V+GQRI ETT+LQ
Sbjct: 62 GVVTVTPRSMDAETYVDGQRISETTMLQ 89
>d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2affa1 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2ff4a3 b.26.1.2 (A:284-382) Probable regulatory protein EmbR, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 99 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
d2g1la1102 Kinesin-like protein kif1c {Human (Homo sapiens) [ 99.93
d1wlna1107 Afadin {Mouse (Mus musculus) [TaxId: 10090]} 99.93
d2ff4a399 Probable regulatory protein EmbR, C-terminal domai 99.78
d2affa198 Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1uhta_118 FHA domain containing protein At4G14490 {Thale cre 99.62
d1mzka_122 Kinase associated protein phosphatase {Thale cress 99.54
d1lgpa_113 Cell cycle checkpoint protein Chfr {Human (Homo sa 99.53
d2piea1127 Ubiquitin ligase protein RNF8 {Human (Homo sapiens 99.51
d1g6ga_127 Phosphotyrosine binding domain of Rad53 {Baker's y 99.45
d1gxca_116 Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.45
d2brfa1101 Polynucleotide kinase 3'-phosphatase {Human (Homo 99.44
d1dmza_158 Phosphotyrosine binding domain of Rad53 {Baker's y 99.41
d1dm9a_104 Heat shock protein 15 kD {Escherichia coli [TaxId: 89.04
d1c06a_159 Ribosomal protein S4 {Bacillus stearothermophilus 86.99
d1kska359 Pseudouridine synthase RsuA N-terminal domain {Esc 86.96
d1vioa258 Pseudouridine synthase RsuA N-terminal domain {Hae 85.83
d1vjka_88 Molybdopterin synthase subunit MoaD {Pyrococcus fu 84.16
d1zud2165 Thiamin biosynthesis sulfur carrier protein ThiS { 82.8
d2gy9d1204 Ribosomal protein S4 {Escherichia coli [TaxId: 562 80.74
>d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: SMAD/FHA domain
superfamily: SMAD/FHA domain
family: FHA domain
domain: Kinesin-like protein kif1c
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.93  E-value=1.9e-26  Score=156.71  Aligned_cols=91  Identities=22%  Similarity=0.238  Sum_probs=83.7

Q ss_pred             eeEEEEecCCCCCCCCCCcEEEEcCCCceEEcCCCCCCCCCcccEEEcCCCCCCCcEEEEEc----CCEEEEEeCCCCCc
Q psy5454           7 KSSLLLKNYNGSEITSGSPKRHRLHPNVTEVGSDRASPYGQSQSLQLFGPNIQPRHCVIAHT----EGIVTVTPCSREAE   82 (129)
Q Consensus         7 ~PhLvnln~dp~ls~~~~~~~~~L~~~~t~IGr~~~~~~~~~~dI~L~g~~I~~~Hc~I~~~----~g~v~L~p~ss~~~   82 (129)
                      .|||+|||+||+++  + .++|+|+++.++|||.       ++||+|.+++|+++||.|...    +..+++.+.++.++
T Consensus         1 tPhL~~l~~Dp~~s--~-~~~y~l~~~~~~iGr~-------~~dI~l~~~~vs~~Ha~i~~~~~~~~~~~~i~d~~s~~g   70 (102)
T d2g1la1           1 TPHLVNLNEDPLMS--E-CLLYHIKDGVTRVGQV-------DMDIKLTGQFIREQHCLFRSIPQPDGEVVVTLEPCEGAE   70 (102)
T ss_dssp             CCEEEECCSSCCSS--S-CCEEECCSEEEEEESS-------SCSEECCCTTCCSEEEEEEEEECTTSCEEEEEEECTTCC
T ss_pred             CCEEEEecCCCccC--c-eEEEEcCCCcEECCCC-------CcCEEecccceeeeeeEEEEEEcCCCcEEEEecCCCCCC
Confidence            59999999999999  8 9999999999999995       489999999999999999873    23789999989999


Q ss_pred             eEEcCEEcceeEEcCCCCEEEEecC
Q psy5454          83 TFVNGQRIFETTILQVVVAASAVAE  107 (129)
Q Consensus        83 t~VNG~~I~~~~~L~~GDrI~~~~~  107 (129)
                      |||||++|.+++.|+|||+|.||..
T Consensus        71 t~VNg~~i~~~~~L~~gD~I~~G~~   95 (102)
T d2g1la1          71 TYVNGKLVTEPLVLKSGNRIVMGKN   95 (102)
T ss_dssp             EEETTEECCSCEECCTTCEEEETTT
T ss_pred             eEECCeEccceeEcCCCCEEEECCC
Confidence            9999999999999999999999853
>d1wlna1 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ff4a3 b.26.1.2 (A:284-382) Probable regulatory protein EmbR, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2affa1 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhta_ b.26.1.2 (A:) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lgpa_ b.26.1.2 (A:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2piea1 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxca_ b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2brfa1 b.26.1.2 (A:8-108) Polynucleotide kinase 3'-phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dmza_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dm9a_ d.66.1.3 (A:) Heat shock protein 15 kD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c06a_ d.66.1.2 (A:) Ribosomal protein S4 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kska3 d.66.1.5 (A:1-59) Pseudouridine synthase RsuA N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vioa2 d.66.1.5 (A:0-57) Pseudouridine synthase RsuA N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vjka_ d.15.3.1 (A:) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zud21 d.15.3.2 (2:2-66) Thiamin biosynthesis sulfur carrier protein ThiS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gy9d1 d.66.1.2 (D:2-205) Ribosomal protein S4 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure