Diaphorina citri psyllid: psy5461


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-
MDAIVDILPSPTERPALAMFQHFGDSLCARAFKVVHDKHRGAVTFFRIYSGAFKKNHVPVLCGSSYKNIGVQKLMDAIVDILPSPTERPALAMFQHFGDSLCARAFKVVHDKHRGAVTFFRIYSGAFKKGQKFYNIHLDQSEQITRLLLAEADDYKEVNEIQCGNIAAVTGLKRERGKDKRTRVIPKPTSVVQCSARWTLNLEVGASSPIISKSKRRQNMI
cccEEEECccccccHHHHHHHHHHHHHHHHHcHHHHHHHcccHHHHHHHHHHHcccCEEcccccccccccHHHHHHHHHHHccccccccccccccccccccHHHHHHHcccccccEEEEEEEEEcEEccccEEEEccccccHHHHHHHHHHccccccccEEEcccEEEEEcccccccccccccccccccCEEEEcccccccHHcccccccccHHHHHcccc
MDAIVDILPSPTERPALAMFQHFGDSLCARAFKVVHDKHRGAVTFFRIYSGAFKKNHVPVLCGSSYKNIGVQKLMDAIVDILPSPTERPALAMFQHFGDSLCARAFKVVHDKHRGAVTFFRIYSGAFKKGQKFYNIHLDQSEQITRLLLAEADDYKEVNEIQCGNIAAVTGLKRERGKDKRTRVIPKPTSVVQCSARWTLNLEVGASSPIISKSKRR****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDAIVDILPSPTERPALAMFQHFGDSLCARAFKVVHDKHRGAVTFFRIYSGAFKKNHVPVLCGSSYKNIGVQKLMDAIVDILPSPTERPALAMFQHFGDSLCARAFKVVHDKHRGAVTFFRIYSGAFKKGQKFYNIHLDQSEQITRLLLAEADDYKEVNEIQCGNIAAVTGLKRERGKDKRTRVIPKPTSVVQCSARWTLNLEVGASSPIISKSKRRQNMI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003924 [MF]GTPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0032790 [BP]ribosome disassemblyprobableGO:0071826, GO:0043933, GO:0071840, GO:0009987, GO:0032984, GO:0032988, GO:0008150, GO:0022411, GO:0016043, GO:0044763, GO:0044699
GO:0070125 [BP]mitochondrial translational elongationprobableGO:0044249, GO:0034645, GO:0044699, GO:0044267, GO:0044260, GO:0071840, GO:0016043, GO:0071704, GO:0010467, GO:0007005, GO:0032543, GO:1901576, GO:0009987, GO:0009058, GO:0009059, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0019538, GO:0044237, GO:0043170, GO:0008150, GO:0006414, GO:0006412
GO:0003746 [MF]translation elongation factor activityprobableGO:0097159, GO:0008135, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0006184 [BP]GTP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0009203, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0071704, GO:0042278, GO:1901069, GO:1901068, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0046039, GO:0044238, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XEX, chain A
Confidence level:very confident
Coverage over the Query: 23-215
View the alignment between query and template
View the model in PyMOL
Template: 2RDO, chain 7
Confidence level:very confident
Coverage over the Query: 1-64
View the alignment between query and template
View the model in PyMOL