Psyllid ID: psy5461
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 221 | ||||||
| 307205784 | 747 | Elongation factor G 2, mitochondrial [Ha | 0.524 | 0.155 | 0.637 | 6e-37 | |
| 328701929 | 742 | PREDICTED: ribosome-releasing factor 2, | 0.520 | 0.154 | 0.620 | 1e-36 | |
| 307191029 | 743 | Elongation factor G 2, mitochondrial [Ca | 0.552 | 0.164 | 0.598 | 1e-35 | |
| 340713650 | 832 | PREDICTED: ribosome-releasing factor 2, | 0.597 | 0.158 | 0.515 | 7e-35 | |
| 322792141 | 695 | hypothetical protein SINV_02354 [Solenop | 0.524 | 0.166 | 0.637 | 1e-34 | |
| 383859899 | 824 | PREDICTED: LOW QUALITY PROTEIN: ribosome | 0.597 | 0.160 | 0.515 | 2e-33 | |
| 328784337 | 831 | PREDICTED: ribosome-releasing factor 2, | 0.597 | 0.158 | 0.515 | 2e-33 | |
| 332030184 | 753 | Ribosome-releasing factor 2, mitochondri | 0.524 | 0.154 | 0.594 | 9e-33 | |
| 189239328 | 740 | PREDICTED: similar to mitochondrial elon | 0.552 | 0.164 | 0.564 | 1e-32 | |
| 350409609 | 845 | PREDICTED: ribosome-releasing factor 2, | 0.597 | 0.156 | 0.507 | 2e-32 |
| >gi|307205784|gb|EFN84014.1| Elongation factor G 2, mitochondrial [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
Score = 159 bits (403), Expect = 6e-37, Method: Compositional matrix adjust.
Identities = 74/116 (63%), Positives = 89/116 (76%)
Query: 58 VPVLCGSSYKNIGVQKLMDAIVDILPSPTERPALAMFQHFGDSLCARAFKVVHDKHRGAV 117
VPV+ GSSYKN+GVQ LMD ++ LPSP L+ ++HFGDSL AR FK+VHDKH+G V
Sbjct: 290 VPVMLGSSYKNVGVQPLMDNVILYLPSPGNLKKLSSYRHFGDSLAARVFKIVHDKHKGPV 349
Query: 118 TFFRIYSGAFKKGQKFYNIHLDQSEQITRLLLAEADDYKEVNEIQCGNIAAVTGLK 173
TFFRIYSG+ KKGQK YN+ QSEQ T L +A A+DY+EV E+ GNIAAV GLK
Sbjct: 350 TFFRIYSGSMKKGQKLYNVTRQQSEQCTYLYIACANDYEEVTEVSYGNIAAVAGLK 405
|
Source: Harpegnathos saltator Species: Harpegnathos saltator Genus: Harpegnathos Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328701929|ref|XP_001944132.2| PREDICTED: ribosome-releasing factor 2, mitochondrial-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|307191029|gb|EFN74783.1| Elongation factor G 2, mitochondrial [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|340713650|ref|XP_003395353.1| PREDICTED: ribosome-releasing factor 2, mitochondrial-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|322792141|gb|EFZ16193.1| hypothetical protein SINV_02354 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|383859899|ref|XP_003705429.1| PREDICTED: LOW QUALITY PROTEIN: ribosome-releasing factor 2, mitochondrial-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|328784337|ref|XP_392362.3| PREDICTED: ribosome-releasing factor 2, mitochondrial-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|332030184|gb|EGI69978.1| Ribosome-releasing factor 2, mitochondrial [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|189239328|ref|XP_973240.2| PREDICTED: similar to mitochondrial elongation factor G2 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|350409609|ref|XP_003488792.1| PREDICTED: ribosome-releasing factor 2, mitochondrial-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 221 | ||||||
| ZFIN|ZDB-GENE-060201-3 | 762 | gfm2 "G elongation factor, mit | 0.524 | 0.152 | 0.504 | 1.1e-23 | |
| UNIPROTKB|Q969S9 | 779 | GFM2 "Ribosome-releasing facto | 0.520 | 0.147 | 0.508 | 1.5e-23 | |
| UNIPROTKB|E2R4T4 | 780 | GFM2 "Uncharacterized protein" | 0.520 | 0.147 | 0.525 | 2.4e-23 | |
| UNIPROTKB|E1C430 | 782 | GFM2 "Uncharacterized protein" | 0.597 | 0.168 | 0.477 | 3.1e-23 | |
| UNIPROTKB|F1S2J6 | 777 | GFM2 "Uncharacterized protein" | 0.520 | 0.148 | 0.525 | 6.5e-23 | |
| UNIPROTKB|Q5R600 | 777 | GFM2 "Ribosome-releasing facto | 0.520 | 0.148 | 0.5 | 8.3e-23 | |
| UNIPROTKB|A6QNM2 | 777 | GFM2 "Ribosome-releasing facto | 0.615 | 0.175 | 0.457 | 1.1e-22 | |
| UNIPROTKB|D4A0Y8 | 741 | Gfm2 "Ribosome-releasing facto | 0.524 | 0.156 | 0.478 | 1.2e-22 | |
| MGI|MGI:2444783 | 779 | Gfm2 "G elongation factor, mit | 0.524 | 0.148 | 0.495 | 1.4e-22 | |
| RGD|1309854 | 779 | Gfm2 "G elongation factor, mit | 0.524 | 0.148 | 0.478 | 1.4e-22 |
| ZFIN|ZDB-GENE-060201-3 gfm2 "G elongation factor, mitochondrial 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 282 (104.3 bits), Expect = 1.1e-23, P = 1.1e-23
Identities = 59/117 (50%), Positives = 78/117 (66%)
Query: 58 VPVLCGSSYKNIGVQKLMDAIVDILPSPTERPALAMFQHFGDSLCARAFKVVHDKHRGAV 117
VPVLCGSS KN GVQ L+DAI LP+P ER + + + + LCA AFKVVHDK RG +
Sbjct: 313 VPVLCGSSLKNKGVQPLLDAITAYLPAPNERNH-DLVRWYKNDLCALAFKVVHDKQRGPL 371
Query: 118 TFFRIYSGAFKKGQKFYNIHLDQSEQITRLLLAEADDYKEVNEIQCGNIAAVTGLKR 174
F RIYSG+ K +NI+ +++E+++RLLL AD E+ + GNIA GLK+
Sbjct: 372 VFVRIYSGSMKAQSSVHNINRNETEKMSRLLLPFADQQIEIPSLSAGNIALTVGLKQ 428
|
|
| UNIPROTKB|Q969S9 GFM2 "Ribosome-releasing factor 2, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R4T4 GFM2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C430 GFM2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S2J6 GFM2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R600 GFM2 "Ribosome-releasing factor 2, mitochondrial" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6QNM2 GFM2 "Ribosome-releasing factor 2, mitochondrial" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A0Y8 Gfm2 "Ribosome-releasing factor 2, mitochondrial" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2444783 Gfm2 "G elongation factor, mitochondrial 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1309854 Gfm2 "G elongation factor, mitochondrial 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 221 | |||
| COG0480 | 697 | COG0480, FusA, Translation elongation factors (GTP | 5e-35 | |
| PRK00007 | 693 | PRK00007, PRK00007, elongation factor G; Reviewed | 5e-33 | |
| PRK12740 | 668 | PRK12740, PRK12740, elongation factor G; Reviewed | 2e-32 | |
| PRK12739 | 691 | PRK12739, PRK12739, elongation factor G; Reviewed | 1e-31 | |
| PRK13351 | 687 | PRK13351, PRK13351, elongation factor G; Reviewed | 8e-31 | |
| cd04092 | 83 | cd04092, mtEFG2_II_like, mtEFG2_C: C-terminus of m | 7e-28 | |
| TIGR00484 | 689 | TIGR00484, EF-G, translation elongation factor EF- | 6e-27 | |
| cd04088 | 83 | cd04088, EFG_mtEFG_II, EFG_mtEFG_II: this subfamil | 1e-24 | |
| cd01886 | 270 | cd01886, EF-G, Elongation factor G (EF-G) family i | 3e-12 | |
| PRK12740 | 668 | PRK12740, PRK12740, elongation factor G; Reviewed | 6e-11 | |
| cd04092 | 83 | cd04092, mtEFG2_II_like, mtEFG2_C: C-terminus of m | 2e-10 | |
| cd04091 | 81 | cd04091, mtEFG1_II_like, mtEFG1_C: C-terminus of m | 2e-10 | |
| COG0480 | 697 | COG0480, FusA, Translation elongation factors (GTP | 4e-10 | |
| cd01342 | 83 | cd01342, Translation_Factor_II_like, Translation_F | 1e-09 | |
| cd04088 | 83 | cd04088, EFG_mtEFG_II, EFG_mtEFG_II: this subfamil | 7e-09 | |
| PRK00007 | 693 | PRK00007, PRK00007, elongation factor G; Reviewed | 9e-09 | |
| PRK13351 | 687 | PRK13351, PRK13351, elongation factor G; Reviewed | 3e-08 | |
| TIGR00490 | 720 | TIGR00490, aEF-2, translation elongation factor aE | 9e-08 | |
| PRK12739 | 691 | PRK12739, PRK12739, elongation factor G; Reviewed | 2e-07 | |
| cd03690 | 85 | cd03690, Tet_II, Tet_II: This subfamily represents | 2e-07 | |
| cd03700 | 93 | cd03700, eEF2_snRNP_like_II, EF2_snRNP_like_II: th | 3e-07 | |
| COG4108 | 528 | COG4108, PrfC, Peptide chain release factor RF-3 [ | 3e-07 | |
| TIGR00503 | 527 | TIGR00503, prfC, peptide chain release factor 3 | 7e-07 | |
| TIGR01393 | 595 | TIGR01393, lepA, GTP-binding protein LepA | 8e-07 | |
| PRK07560 | 731 | PRK07560, PRK07560, elongation factor EF-2; Review | 9e-07 | |
| pfam03144 | 70 | pfam03144, GTP_EFTU_D2, Elongation factor Tu domai | 9e-07 | |
| TIGR00484 | 689 | TIGR00484, EF-G, translation elongation factor EF- | 1e-06 | |
| PRK00741 | 526 | PRK00741, prfC, peptide chain release factor 3; Pr | 1e-06 | |
| COG0481 | 603 | COG0481, LepA, Membrane GTPase LepA [Cell envelope | 1e-06 | |
| cd04170 | 268 | cd04170, EF-G_bact, Elongation factor G (EF-G) fam | 2e-06 | |
| PRK05433 | 600 | PRK05433, PRK05433, GTP-binding protein LepA; Prov | 3e-06 | |
| pfam00009 | 184 | pfam00009, GTP_EFTU, Elongation factor Tu GTP bind | 4e-05 | |
| cd03691 | 86 | cd03691, BipA_TypA_II, BipA_TypA_II: domain II of | 2e-04 | |
| cd04090 | 94 | cd04090, eEF2_II_snRNP, Loc2 eEF2_C_snRNP, cd01514 | 7e-04 | |
| TIGR01394 | 594 | TIGR01394, TypA_BipA, GTP-binding protein TypA/Bip | 7e-04 | |
| COG1217 | 603 | COG1217, TypA, Predicted membrane GTPase involved | 0.001 | |
| cd04169 | 268 | cd04169, RF3, Release Factor 3 (RF3) protein invol | 0.002 | |
| cd01342 | 83 | cd01342, Translation_Factor_II_like, Translation_F | 0.003 |
| >gnl|CDD|223556 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Score = 130 bits (329), Expect = 5e-35
Identities = 53/128 (41%), Positives = 76/128 (59%), Gaps = 12/128 (9%)
Query: 58 VPVLCGSSYKNIGVQKLMDAIVDILPSPTERPAL----------AMFQHFGDS--LCARA 105
VPVLCGS++KN GVQ L+DA+VD LPSP + P + A+ + D L A
Sbjct: 253 VPVLCGSAFKNKGVQPLLDAVVDYLPSPLDVPPIKGDLDDEIEKAVLRKASDEGPLSALV 312
Query: 106 FKVVHDKHRGAVTFFRIYSGAFKKGQKFYNIHLDQSEQITRLLLAEADDYKEVNEIQCGN 165
FK++ D G +TF R+YSG K G + N + E++ RLLL ++ +EV+E+ G+
Sbjct: 313 FKIMTDPFVGKLTFVRVYSGTLKSGSEVLNSTKGKKERVGRLLLMHGNEREEVDEVPAGD 372
Query: 166 IAAVTGLK 173
I A+ GLK
Sbjct: 373 IVALVGLK 380
|
Length = 697 |
| >gnl|CDD|234569 PRK00007, PRK00007, elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237186 PRK12740, PRK12740, elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237185 PRK12739, PRK12739, elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237358 PRK13351, PRK13351, elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|239759 cd04092, mtEFG2_II_like, mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes | Back alignment and domain information |
|---|
| >gnl|CDD|129575 TIGR00484, EF-G, translation elongation factor EF-G | Back alignment and domain information |
|---|
| >gnl|CDD|239755 cd04088, EFG_mtEFG_II, EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes | Back alignment and domain information |
|---|
| >gnl|CDD|206673 cd01886, EF-G, Elongation factor G (EF-G) family involved in both the elongation and ribosome recycling phases of protein synthesis | Back alignment and domain information |
|---|
| >gnl|CDD|237186 PRK12740, PRK12740, elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|239759 cd04092, mtEFG2_II_like, mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes | Back alignment and domain information |
|---|
| >gnl|CDD|239758 cd04091, mtEFG1_II_like, mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes | Back alignment and domain information |
|---|
| >gnl|CDD|223556 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|238652 cd01342, Translation_Factor_II_like, Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239755 cd04088, EFG_mtEFG_II, EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes | Back alignment and domain information |
|---|
| >gnl|CDD|234569 PRK00007, PRK00007, elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237358 PRK13351, PRK13351, elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|129581 TIGR00490, aEF-2, translation elongation factor aEF-2 | Back alignment and domain information |
|---|
| >gnl|CDD|237185 PRK12739, PRK12739, elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|239661 cd03690, Tet_II, Tet_II: This subfamily represents domain II of ribosomal protection proteins Tet(M) and Tet(O) | Back alignment and domain information |
|---|
| >gnl|CDD|239671 cd03700, eEF2_snRNP_like_II, EF2_snRNP_like_II: this subfamily represents domain II of elongation factor (EF) EF-2 found eukaryotes and archaea and, the C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p | Back alignment and domain information |
|---|
| >gnl|CDD|226593 COG4108, PrfC, Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|129594 TIGR00503, prfC, peptide chain release factor 3 | Back alignment and domain information |
|---|
| >gnl|CDD|130460 TIGR01393, lepA, GTP-binding protein LepA | Back alignment and domain information |
|---|
| >gnl|CDD|236047 PRK07560, PRK07560, elongation factor EF-2; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|217388 pfam03144, GTP_EFTU_D2, Elongation factor Tu domain 2 | Back alignment and domain information |
|---|
| >gnl|CDD|129575 TIGR00484, EF-G, translation elongation factor EF-G | Back alignment and domain information |
|---|
| >gnl|CDD|179105 PRK00741, prfC, peptide chain release factor 3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223557 COG0481, LepA, Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|206733 cd04170, EF-G_bact, Elongation factor G (EF-G) family | Back alignment and domain information |
|---|
| >gnl|CDD|235462 PRK05433, PRK05433, GTP-binding protein LepA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|239662 cd03691, BipA_TypA_II, BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu | Back alignment and domain information |
|---|
| >gnl|CDD|239757 cd04090, eEF2_II_snRNP, Loc2 eEF2_C_snRNP, cd01514/C terminal domain:eEF2_C_snRNP: This family includes C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p | Back alignment and domain information |
|---|
| >gnl|CDD|233394 TIGR01394, TypA_BipA, GTP-binding protein TypA/BipA | Back alignment and domain information |
|---|
| >gnl|CDD|224138 COG1217, TypA, Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|206732 cd04169, RF3, Release Factor 3 (RF3) protein involved in the terminal step of translocation in bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|238652 cd01342, Translation_Factor_II_like, Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 221 | |||
| KOG0465|consensus | 721 | 100.0 | ||
| PRK00007 | 693 | elongation factor G; Reviewed | 100.0 | |
| TIGR00503 | 527 | prfC peptide chain release factor 3. This translat | 100.0 | |
| TIGR00484 | 689 | EF-G translation elongation factor EF-G. After pep | 100.0 | |
| PRK00741 | 526 | prfC peptide chain release factor 3; Provisional | 100.0 | |
| PRK12739 | 691 | elongation factor G; Reviewed | 100.0 | |
| PRK13351 | 687 | elongation factor G; Reviewed | 100.0 | |
| COG0480 | 697 | FusA Translation elongation factors (GTPases) [Tra | 100.0 | |
| PRK12740 | 668 | elongation factor G; Reviewed | 99.97 | |
| PRK10218 | 607 | GTP-binding protein; Provisional | 99.95 | |
| PRK07560 | 731 | elongation factor EF-2; Reviewed | 99.95 | |
| TIGR01394 | 594 | TypA_BipA GTP-binding protein TypA/BipA. This bact | 99.95 | |
| TIGR01393 | 595 | lepA GTP-binding protein LepA. LepA (GUF1 in Sacca | 99.94 | |
| PRK05433 | 600 | GTP-binding protein LepA; Provisional | 99.94 | |
| TIGR00490 | 720 | aEF-2 translation elongation factor aEF-2. This mo | 99.93 | |
| COG4108 | 528 | PrfC Peptide chain release factor RF-3 [Translatio | 99.92 | |
| PLN00116 | 843 | translation elongation factor EF-2 subunit; Provis | 99.92 | |
| PTZ00416 | 836 | elongation factor 2; Provisional | 99.91 | |
| COG0481 | 603 | LepA Membrane GTPase LepA [Cell envelope biogenesi | 99.91 | |
| COG1217 | 603 | TypA Predicted membrane GTPase involved in stress | 99.89 | |
| KOG0464|consensus | 753 | 99.88 | ||
| cd03690 | 85 | Tet_II Tet_II: This subfamily represents domain II | 99.88 | |
| KOG0462|consensus | 650 | 99.87 | ||
| cd04092 | 83 | mtEFG2_II_like mtEFG2_C: C-terminus of mitochondri | 99.87 | |
| cd04088 | 83 | EFG_mtEFG_II EFG_mtEFG_II: this subfamily represen | 99.86 | |
| cd03689 | 85 | RF3_II RF3_II: this subfamily represents the domai | 99.85 | |
| cd04091 | 81 | mtEFG1_II_like mtEFG1_C: C-terminus of mitochondri | 99.85 | |
| cd03691 | 86 | BipA_TypA_II BipA_TypA_II: domain II of BipA (also | 99.82 | |
| cd03699 | 86 | lepA_II lepA_II: This subfamily represents the dom | 99.81 | |
| KOG0469|consensus | 842 | 99.76 | ||
| cd03700 | 93 | eEF2_snRNP_like_II EF2_snRNP_like_II: this subfami | 99.76 | |
| cd04090 | 94 | eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C termina | 99.73 | |
| PRK05306 | 787 | infB translation initiation factor IF-2; Validated | 99.69 | |
| PRK12736 | 394 | elongation factor Tu; Reviewed | 99.6 | |
| TIGR00487 | 587 | IF-2 translation initiation factor IF-2. This mode | 99.59 | |
| CHL00189 | 742 | infB translation initiation factor 2; Provisional | 99.57 | |
| CHL00071 | 409 | tufA elongation factor Tu | 99.57 | |
| TIGR00485 | 394 | EF-Tu translation elongation factor TU. This align | 99.55 | |
| KOG0460|consensus | 449 | 99.55 | ||
| PRK12735 | 396 | elongation factor Tu; Reviewed | 99.51 | |
| PRK00049 | 396 | elongation factor Tu; Reviewed | 99.47 | |
| PTZ00327 | 460 | eukaryotic translation initiation factor 2 gamma s | 99.45 | |
| TIGR00483 | 426 | EF-1_alpha translation elongation factor EF-1 alph | 99.44 | |
| PRK12317 | 425 | elongation factor 1-alpha; Reviewed | 99.43 | |
| PRK04000 | 411 | translation initiation factor IF-2 subunit gamma; | 99.42 | |
| PRK10512 | 614 | selenocysteinyl-tRNA-specific translation factor; | 99.41 | |
| PLN00043 | 447 | elongation factor 1-alpha; Provisional | 99.4 | |
| PLN03127 | 447 | Elongation factor Tu; Provisional | 99.39 | |
| PTZ00141 | 446 | elongation factor 1- alpha; Provisional | 99.38 | |
| PF03144 | 74 | GTP_EFTU_D2: Elongation factor Tu domain 2; InterP | 99.38 | |
| TIGR03680 | 406 | eif2g_arch translation initiation factor 2 subunit | 99.36 | |
| KOG0468|consensus | 971 | 99.35 | ||
| PLN03126 | 478 | Elongation factor Tu; Provisional | 99.32 | |
| COG0050 | 394 | TufB GTPases - translation elongation factors [Tra | 99.32 | |
| COG5258 | 527 | GTPBP1 GTPase [General function prediction only] | 99.28 | |
| cd01342 | 83 | Translation_Factor_II_like Translation_Factor_II_l | 99.21 | |
| TIGR00475 | 581 | selB selenocysteine-specific elongation factor Sel | 99.21 | |
| PRK05124 | 474 | cysN sulfate adenylyltransferase subunit 1; Provis | 99.15 | |
| COG5256 | 428 | TEF1 Translation elongation factor EF-1alpha (GTPa | 99.14 | |
| COG3276 | 447 | SelB Selenocysteine-specific translation elongatio | 99.12 | |
| TIGR02034 | 406 | CysN sulfate adenylyltransferase, large subunit. H | 99.12 | |
| KOG1145|consensus | 683 | 99.07 | ||
| PRK04004 | 586 | translation initiation factor IF-2; Validated | 99.07 | |
| cd03698 | 83 | eRF3_II_like eRF3_II_like: domain similar to domai | 99.05 | |
| COG0532 | 509 | InfB Translation initiation factor 2 (IF-2; GTPase | 98.98 | |
| cd03693 | 91 | EF1_alpha_II EF1_alpha_II: this family represents | 98.98 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 98.98 | |
| PRK14845 | 1049 | translation initiation factor IF-2; Provisional | 98.96 | |
| TIGR00491 | 590 | aIF-2 translation initiation factor aIF-2/yIF-2. T | 98.9 | |
| cd04089 | 82 | eRF3_II eRF3_II: domain II of the eukaryotic class | 98.84 | |
| KOG0467|consensus | 887 | 98.75 | ||
| cd03695 | 81 | CysN_NodQ_II CysN_NodQ_II: This subfamily represen | 98.73 | |
| cd03696 | 83 | selB_II selB_II: this subfamily represents the dom | 98.69 | |
| cd03694 | 87 | GTPBP_II Domain II of the GP-1 family of GTPase. T | 98.68 | |
| cd04168 | 237 | TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T | 98.63 | |
| cd03697 | 87 | EFTU_II EFTU_II: Elongation factor Tu domain II. E | 98.61 | |
| cd01886 | 270 | EF-G Elongation factor G (EF-G) subfamily. Translo | 98.53 | |
| cd04169 | 267 | RF3 RF3 subfamily. Peptide chain release factor 3 | 98.52 | |
| cd03702 | 95 | IF2_mtIF2_II This family represents the domain II | 98.49 | |
| cd03692 | 84 | mtIF2_IVc mtIF2_IVc: this family represents the C2 | 98.44 | |
| COG5257 | 415 | GCD11 Translation initiation factor 2, gamma subun | 98.42 | |
| KOG0461|consensus | 522 | 98.42 | ||
| KOG0465|consensus | 721 | 98.41 | ||
| cd04170 | 268 | EF-G_bact Elongation factor G (EF-G) subfamily. Tr | 98.36 | |
| KOG0459|consensus | 501 | 98.36 | ||
| cd03701 | 95 | IF2_IF5B_II IF2_IF5B_II: This family represents th | 98.28 | |
| KOG0458|consensus | 603 | 98.26 | ||
| COG2895 | 431 | CysN GTPases - Sulfate adenylate transferase subun | 97.97 | |
| KOG0464|consensus | 753 | 97.93 | ||
| cd03703 | 110 | aeIF5B_II aeIF5B_II: This family represents the do | 97.87 | |
| KOG0463|consensus | 641 | 97.77 | ||
| TIGR00503 | 527 | prfC peptide chain release factor 3. This translat | 97.76 | |
| cd03688 | 113 | eIF2_gamma_II eIF2_gamma_II: this subfamily repres | 97.63 | |
| PRK00741 | 526 | prfC peptide chain release factor 3; Provisional | 97.54 | |
| COG0480 | 697 | FusA Translation elongation factors (GTPases) [Tra | 97.48 | |
| PRK00007 | 693 | elongation factor G; Reviewed | 97.37 | |
| PRK12739 | 691 | elongation factor G; Reviewed | 97.37 | |
| PF00009 | 188 | GTP_EFTU: Elongation factor Tu GTP binding domain; | 97.27 | |
| TIGR00484 | 689 | EF-G translation elongation factor EF-G. After pep | 97.23 | |
| KOG1143|consensus | 591 | 97.23 | ||
| PF14578 | 81 | GTP_EFTU_D4: Elongation factor Tu domain 4; PDB: 1 | 97.13 | |
| PF14492 | 75 | EFG_II: Elongation Factor G, domain II; PDB: 1WDT_ | 97.02 | |
| PRK13351 | 687 | elongation factor G; Reviewed | 96.99 | |
| PRK07560 | 731 | elongation factor EF-2; Reviewed | 96.97 | |
| PTZ00416 | 836 | elongation factor 2; Provisional | 96.9 | |
| TIGR00490 | 720 | aEF-2 translation elongation factor aEF-2. This mo | 96.83 | |
| PLN00116 | 843 | translation elongation factor EF-2 subunit; Provis | 96.73 | |
| PRK12740 | 668 | elongation factor G; Reviewed | 96.56 | |
| cd03690 | 85 | Tet_II Tet_II: This subfamily represents domain II | 95.89 | |
| COG4108 | 528 | PrfC Peptide chain release factor RF-3 [Translatio | 95.8 | |
| TIGR00487 | 587 | IF-2 translation initiation factor IF-2. This mode | 95.55 | |
| PF10662 | 143 | PduV-EutP: Ethanolamine utilisation - propanediol | 95.4 | |
| KOG0466|consensus | 466 | 95.34 | ||
| cd01889 | 192 | SelB_euk SelB subfamily. SelB is an elongation fac | 95.32 | |
| CHL00189 | 742 | infB translation initiation factor 2; Provisional | 95.3 | |
| PRK05306 | 787 | infB translation initiation factor IF-2; Validated | 95.19 | |
| cd00881 | 189 | GTP_translation_factor GTP translation factor fami | 95.12 | |
| cd04091 | 81 | mtEFG1_II_like mtEFG1_C: C-terminus of mitochondri | 95.1 | |
| cd01888 | 203 | eIF2_gamma eIF2-gamma (gamma subunit of initiation | 95.08 | |
| cd04092 | 83 | mtEFG2_II_like mtEFG2_C: C-terminus of mitochondri | 94.84 | |
| cd01890 | 179 | LepA LepA subfamily. LepA belongs to the GTPase fa | 94.61 | |
| COG0532 | 509 | InfB Translation initiation factor 2 (IF-2; GTPase | 94.38 | |
| cd04088 | 83 | EFG_mtEFG_II EFG_mtEFG_II: this subfamily represen | 94.34 | |
| cd03699 | 86 | lepA_II lepA_II: This subfamily represents the dom | 93.86 | |
| PRK10218 | 607 | GTP-binding protein; Provisional | 93.61 | |
| cd04165 | 224 | GTPBP1_like GTPBP1-like. Mammalian GTP binding pro | 93.16 | |
| cd01884 | 195 | EF_Tu EF-Tu subfamily. This subfamily includes ort | 93.11 | |
| cd01891 | 194 | TypA_BipA TypA (tyrosine phosphorylated protein A) | 93.04 | |
| KOG1144|consensus | 1064 | 92.83 | ||
| TIGR00436 | 270 | era GTP-binding protein Era. Era is an essential G | 92.77 | |
| TIGR01393 | 595 | lepA GTP-binding protein LepA. LepA (GUF1 in Sacca | 92.56 | |
| TIGR01394 | 594 | TypA_BipA GTP-binding protein TypA/BipA. This bact | 92.24 | |
| PRK15467 | 158 | ethanolamine utilization protein EutP; Provisional | 92.12 | |
| cd01885 | 222 | EF2 EF2 (for archaea and eukarya). Translocation r | 91.9 | |
| cd04139 | 164 | RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) | 91.88 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 91.75 | |
| PRK05433 | 600 | GTP-binding protein LepA; Provisional | 91.69 | |
| cd01897 | 168 | NOG NOG1 is a nucleolar GTP-binding protein presen | 91.47 | |
| cd04145 | 164 | M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf | 91.24 | |
| cd03689 | 85 | RF3_II RF3_II: this subfamily represents the domai | 91.16 | |
| cd04136 | 163 | Rap_like Rap-like subfamily. The Rap subfamily con | 91.05 | |
| cd04147 | 198 | Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v | 90.92 | |
| smart00173 | 164 | RAS Ras subfamily of RAS small GTPases. Similar in | 90.87 | |
| TIGR02528 | 142 | EutP ethanolamine utilization protein, EutP. This | 90.76 | |
| cd04157 | 162 | Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub | 90.71 | |
| cd01860 | 163 | Rab5_related Rab5-related subfamily. This subfamil | 90.7 | |
| TIGR00491 | 590 | aIF-2 translation initiation factor aIF-2/yIF-2. T | 90.63 | |
| PF02421 | 156 | FeoB_N: Ferrous iron transport protein B; InterPro | 90.59 | |
| cd04116 | 170 | Rab9 Rab9 subfamily. Rab9 is found in late endosom | 90.47 | |
| cd04138 | 162 | H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, | 90.46 | |
| cd01865 | 165 | Rab3 Rab3 subfamily. The Rab3 subfamily contains R | 90.37 | |
| cd04160 | 167 | Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote | 90.34 | |
| cd03691 | 86 | BipA_TypA_II BipA_TypA_II: domain II of BipA (also | 89.98 | |
| cd01862 | 172 | Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th | 89.89 | |
| cd04154 | 173 | Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are | 89.88 | |
| cd04175 | 164 | Rap1 Rap1 subgroup. The Rap1 subgroup is part of t | 89.52 | |
| cd01863 | 161 | Rab18 Rab18 subfamily. Mammalian Rab18 is implicat | 89.47 | |
| cd00880 | 163 | Era_like Era (E. coli Ras-like protein)-like. This | 89.41 | |
| PRK04004 | 586 | translation initiation factor IF-2; Validated | 89.32 | |
| cd04151 | 158 | Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t | 89.17 | |
| cd04106 | 162 | Rab23_lke Rab23-like subfamily. Rab23 is a member | 88.88 | |
| cd04177 | 168 | RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the | 88.8 | |
| cd04158 | 169 | ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor | 88.71 | |
| cd04156 | 160 | ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su | 88.55 | |
| cd01855 | 190 | YqeH YqeH. YqeH is an essential GTP-binding protei | 88.54 | |
| cd04143 | 247 | Rhes_like Rhes_like subfamily. This subfamily incl | 88.47 | |
| cd04107 | 201 | Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 | 88.46 | |
| cd04119 | 168 | RJL RJL (RabJ-Like) subfamily. RJLs are found in m | 88.32 | |
| cd01864 | 165 | Rab19 Rab19 subfamily. Rab19 proteins are associat | 88.28 | |
| cd00876 | 160 | Ras Ras family. The Ras family of the Ras superfam | 88.26 | |
| cd04090 | 94 | eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C termina | 88.09 | |
| cd04150 | 159 | Arf1_5_like Arf1-Arf5-like subfamily. This subfami | 88.05 | |
| cd01887 | 168 | IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo | 88.01 | |
| cd03700 | 93 | eEF2_snRNP_like_II EF2_snRNP_like_II: this subfami | 87.95 | |
| cd00879 | 190 | Sar1 Sar1 subfamily. Sar1 is an essential componen | 87.94 | |
| cd04153 | 174 | Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a | 87.81 | |
| cd04113 | 161 | Rab4 Rab4 subfamily. Rab4 has been implicated in n | 87.76 | |
| cd04155 | 173 | Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f | 87.74 | |
| cd01859 | 156 | MJ1464 MJ1464. This family represents archaeal GTP | 87.62 | |
| TIGR02729 | 329 | Obg_CgtA Obg family GTPase CgtA. This model descri | 87.48 | |
| COG0481 | 603 | LepA Membrane GTPase LepA [Cell envelope biogenesi | 87.36 | |
| COG4917 | 148 | EutP Ethanolamine utilization protein [Amino acid | 87.23 | |
| smart00175 | 164 | RAB Rab subfamily of small GTPases. Rab GTPases ar | 87.22 | |
| PRK00089 | 292 | era GTPase Era; Reviewed | 87.16 | |
| cd01898 | 170 | Obg Obg subfamily. The Obg nucleotide binding prot | 87.15 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 87.05 | |
| cd04152 | 183 | Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i | 87.05 | |
| cd04149 | 168 | Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor | 86.95 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 86.84 | |
| PRK04213 | 201 | GTP-binding protein; Provisional | 86.82 | |
| cd04159 | 159 | Arl10_like Arl10-like subfamily. Arl9/Arl10 was id | 86.82 | |
| cd01861 | 161 | Rab6 Rab6 subfamily. Rab6 is involved in microtubu | 86.69 | |
| cd00878 | 158 | Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik | 86.63 | |
| cd04142 | 198 | RRP22 RRP22 subfamily. RRP22 (Ras-related protein | 86.57 | |
| cd01868 | 165 | Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a | 86.33 | |
| PRK12299 | 335 | obgE GTPase CgtA; Reviewed | 86.31 | |
| cd04134 | 189 | Rho3 Rho3 subfamily. Rho3 is a member of the Rho f | 85.97 | |
| COG1159 | 298 | Era GTPase [General function prediction only] | 85.97 | |
| cd04135 | 174 | Tc10 TC10 subfamily. TC10 is a Rho family protein | 85.84 | |
| cd01894 | 157 | EngA1 EngA1 subfamily. This CD represents the firs | 85.74 | |
| cd04176 | 163 | Rap2 Rap2 subgroup. The Rap2 subgroup is part of t | 85.67 | |
| cd01869 | 166 | Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev | 85.67 | |
| cd00154 | 159 | Rab Rab family. Rab GTPases form the largest famil | 85.65 | |
| cd04114 | 169 | Rab30 Rab30 subfamily. Rab30 appears to be associa | 85.57 | |
| PRK15494 | 339 | era GTPase Era; Provisional | 85.49 | |
| cd01870 | 175 | RhoA_like RhoA-like subfamily. The RhoA subfamily | 85.45 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 85.44 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 85.15 | |
| PTZ00369 | 189 | Ras-like protein; Provisional | 85.13 | |
| TIGR00101 | 199 | ureG urease accessory protein UreG. This model rep | 84.92 | |
| PRK14845 | 1049 | translation initiation factor IF-2; Provisional | 84.82 | |
| cd04101 | 164 | RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove | 84.81 | |
| cd04164 | 157 | trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein | 84.76 | |
| cd04124 | 161 | RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily | 84.56 | |
| cd04127 | 180 | Rab27A Rab27a subfamily. The Rab27a subfamily cons | 84.48 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 84.37 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 84.32 | |
| smart00177 | 175 | ARF ARF-like small GTPases; ARF, ADP-ribosylation | 84.09 | |
| cd01881 | 176 | Obg_like The Obg-like subfamily consists of five w | 84.08 | |
| cd04110 | 199 | Rab35 Rab35 subfamily. Rab35 is one of several Rab | 84.08 | |
| PTZ00133 | 182 | ADP-ribosylation factor; Provisional | 83.96 | |
| PLN00223 | 181 | ADP-ribosylation factor; Provisional | 83.81 | |
| smart00174 | 174 | RHO Rho (Ras homology) subfamily of Ras-like small | 83.72 | |
| cd04123 | 162 | Rab21 Rab21 subfamily. The localization and functi | 83.69 | |
| cd04171 | 164 | SelB SelB subfamily. SelB is an elongation factor | 83.22 | |
| PTZ00099 | 176 | rab6; Provisional | 82.99 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 82.88 | |
| cd00157 | 171 | Rho Rho (Ras homology) family. Members of the Rho | 82.86 | |
| cd04112 | 191 | Rab26 Rab26 subfamily. First identified in rat pan | 82.75 | |
| PRK12298 | 390 | obgE GTPase CgtA; Reviewed | 82.39 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 82.33 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 82.31 | |
| cd04140 | 165 | ARHI_like ARHI subfamily. ARHI (A Ras homolog memb | 81.98 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 81.96 | |
| cd04109 | 215 | Rab28 Rab28 subfamily. First identified in maize, | 81.85 | |
| PLN03110 | 216 | Rab GTPase; Provisional | 81.61 | |
| cd04132 | 187 | Rho4_like Rho4-like subfamily. Rho4 is a GTPase th | 81.6 | |
| cd01895 | 174 | EngA2 EngA2 subfamily. This CD represents the seco | 81.57 | |
| cd04167 | 213 | Snu114p Snu114p subfamily. Snu114p is one of sever | 81.32 | |
| PRK13768 | 253 | GTPase; Provisional | 81.19 | |
| cd04163 | 168 | Era Era subfamily. Era (E. coli Ras-like protein) | 81.13 | |
| cd04125 | 188 | RabA_like RabA-like subfamily. RabA was first iden | 80.71 | |
| cd04141 | 172 | Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p | 80.49 | |
| cd00882 | 157 | Ras_like_GTPase Ras-like GTPase superfamily. The R | 80.48 | |
| cd04137 | 180 | RheB Rheb (Ras Homolog Enriched in Brain) subfamil | 80.38 | |
| cd01849 | 155 | YlqF_related_GTPase YlqF-related GTPases. These pr | 80.31 | |
| cd04130 | 173 | Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive | 80.18 |
| >KOG0465|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.3e-35 Score=265.52 Aligned_cols=193 Identities=29% Similarity=0.460 Sum_probs=167.0
Q ss_pred CCCCceeeeeeeecccccCCcchHHHHhhccccccCceeEecCCCccccHHHHHHHHHhhCCCCCCccccccc-------
Q psy5461 22 HFGDSLCARAFKVVHDKHRGAVTFFRIYSGAFKKNHVPVLCGSSYKNIGVQKLMDAIVDILPSPTERPALAMF------- 94 (221)
Q Consensus 22 ~~~~~~~~~vfk~~~d~~~g~l~~~~l~~~~~~~~~~Pv~~gSa~~~~Gi~~LLd~I~~~~PsP~~~~~~~~~------- 94 (221)
+.|+.++..+.. ......+-....||+.++++.++|||+|||++|.||++|||+|++|+|+|.+..++.+.
T Consensus 249 d~DE~l~e~fLe--e~~ps~~~l~~aIRr~Ti~r~fvPVl~GSAlKNkGVQPlLDAVvdYLPsP~Ev~n~a~~ke~~~~e 326 (721)
T KOG0465|consen 249 DVDETLAEMFLE--EEEPSAQQLKAAIRRATIKRSFVPVLCGSALKNKGVQPLLDAVVDYLPSPSEVENYALNKETNSKE 326 (721)
T ss_pred hhhHHHHHHHhc--cCCCCHHHHHHHHHHHHhhcceeeEEechhhcccCcchHHHHHHHhCCChhhhcccccccCCCCcc
Confidence 346666555544 11235667788999999999999999999999999999999999999999987765321
Q ss_pred -----CCCCC-CcEEEEEEEeecCCCceEEEEEEEceEEcCCCEEEeccCCceeeeceeEeeecCCeeeeCccccCCEEE
Q psy5461 95 -----QHFGD-SLCARAFKVVHDKHRGAVTFFRIYSGAFKKGQKFYNIHLDQSEQITRLLLAEADDYKEVNEIQCGNIAA 168 (221)
Q Consensus 95 -----~~~~~-~~~~~Vfk~~~d~~~G~i~~~RV~sG~L~~gd~v~~~~~~~~~~v~~i~~~~g~~~~~v~~a~aGdIv~ 168 (221)
...++ ||+|.+||+..+++ |.++|+|||+|+|++||.+||.++++++|+.+|..|++...++++++.|||||+
T Consensus 327 kv~l~~~~d~~Pfv~LAFKle~g~f-GqLTyvRvYqG~L~kG~~iyN~rtgKKvrv~RL~rmHa~~medV~~v~AG~I~a 405 (721)
T KOG0465|consen 327 KVTLSPSRDKDPFVALAFKLEEGRF-GQLTYVRVYQGTLSKGDTIYNVRTGKKVRVGRLVRMHANDMEDVNEVLAGDICA 405 (721)
T ss_pred ceEeccCCCCCceeeeEEEeeecCc-cceEEEEEeeeeecCCcEEEecCCCceeEhHHHhHhcccccchhhhhhccceee
Confidence 22333 99999999999999 999999999999999999999999999999999999999999999999999999
Q ss_pred EcCCCCCccCcEEecCC---------CCCCCce----------ehHHHHHHHHHHhhcCCceEEEcccc
Q psy5461 169 VTGLKRERGKDKRTRVI---------PKPTSVV----------QCSARWTLNLEVGASSPIISKSKRRQ 218 (221)
Q Consensus 169 i~gl~~~~~Gdtl~~~~---------~~p~~~v----------~~~~l~~~L~~L~~~Dp~l~~~~~~~ 218 (221)
+.|+ ++.+||||++.. .-|.|++ |.+++++||.++.+|||++.+..|-.
T Consensus 406 lfGi-dcasGDTftd~~~~~~~m~si~vPePVis~aikP~~k~d~~~fskaL~rf~~EDPtFrv~~d~E 473 (721)
T KOG0465|consen 406 LFGI-DCASGDTFTDKQNLALSMESIHIPEPVISVAIKPVNKKDADNFSKALNRFTKEDPTFRVSLDPE 473 (721)
T ss_pred eecc-ccccCceeccCccccceeeeeecCCCeeEEEecccccccHHHHHHHHHhhcccCCceEEEeccc
Confidence 9999 899999998861 2355666 78899999999999999999988753
|
|
| >PRK00007 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >TIGR00503 prfC peptide chain release factor 3 | Back alignment and domain information |
|---|
| >TIGR00484 EF-G translation elongation factor EF-G | Back alignment and domain information |
|---|
| >PRK00741 prfC peptide chain release factor 3; Provisional | Back alignment and domain information |
|---|
| >PRK12739 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >PRK13351 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK12740 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >PRK10218 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK07560 elongation factor EF-2; Reviewed | Back alignment and domain information |
|---|
| >TIGR01394 TypA_BipA GTP-binding protein TypA/BipA | Back alignment and domain information |
|---|
| >TIGR01393 lepA GTP-binding protein LepA | Back alignment and domain information |
|---|
| >PRK05433 GTP-binding protein LepA; Provisional | Back alignment and domain information |
|---|
| >TIGR00490 aEF-2 translation elongation factor aEF-2 | Back alignment and domain information |
|---|
| >COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN00116 translation elongation factor EF-2 subunit; Provisional | Back alignment and domain information |
|---|
| >PTZ00416 elongation factor 2; Provisional | Back alignment and domain information |
|---|
| >COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0464|consensus | Back alignment and domain information |
|---|
| >cd03690 Tet_II Tet_II: This subfamily represents domain II of ribosomal protection proteins Tet(M) and Tet(O) | Back alignment and domain information |
|---|
| >KOG0462|consensus | Back alignment and domain information |
|---|
| >cd04092 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes | Back alignment and domain information |
|---|
| >cd04088 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes | Back alignment and domain information |
|---|
| >cd03689 RF3_II RF3_II: this subfamily represents the domain II of bacterial Release Factor 3 (RF3) | Back alignment and domain information |
|---|
| >cd04091 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes | Back alignment and domain information |
|---|
| >cd03691 BipA_TypA_II BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu | Back alignment and domain information |
|---|
| >cd03699 lepA_II lepA_II: This subfamily represents the domain II of LepA, a GTP-binding protein localized in the cytoplasmic membrane | Back alignment and domain information |
|---|
| >KOG0469|consensus | Back alignment and domain information |
|---|
| >cd03700 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfamily represents domain II of elongation factor (EF) EF-2 found eukaryotes and archaea and, the C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p | Back alignment and domain information |
|---|
| >cd04090 eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C terminal domain:eEF2_C_snRNP: This family includes C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p | Back alignment and domain information |
|---|
| >PRK05306 infB translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >PRK12736 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >TIGR00487 IF-2 translation initiation factor IF-2 | Back alignment and domain information |
|---|
| >CHL00189 infB translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >CHL00071 tufA elongation factor Tu | Back alignment and domain information |
|---|
| >TIGR00485 EF-Tu translation elongation factor TU | Back alignment and domain information |
|---|
| >KOG0460|consensus | Back alignment and domain information |
|---|
| >PRK12735 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >PRK00049 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha | Back alignment and domain information |
|---|
| >PRK12317 elongation factor 1-alpha; Reviewed | Back alignment and domain information |
|---|
| >PRK04000 translation initiation factor IF-2 subunit gamma; Validated | Back alignment and domain information |
|---|
| >PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional | Back alignment and domain information |
|---|
| >PLN00043 elongation factor 1-alpha; Provisional | Back alignment and domain information |
|---|
| >PLN03127 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >PTZ00141 elongation factor 1- alpha; Provisional | Back alignment and domain information |
|---|
| >PF03144 GTP_EFTU_D2: Elongation factor Tu domain 2; InterPro: IPR004161 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] | Back alignment and domain information |
|---|
| >TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma | Back alignment and domain information |
|---|
| >KOG0468|consensus | Back alignment and domain information |
|---|
| >PLN03126 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG5258 GTPBP1 GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01342 Translation_Factor_II_like Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins | Back alignment and domain information |
|---|
| >TIGR00475 selB selenocysteine-specific elongation factor SelB | Back alignment and domain information |
|---|
| >PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional | Back alignment and domain information |
|---|
| >COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02034 CysN sulfate adenylyltransferase, large subunit | Back alignment and domain information |
|---|
| >KOG1145|consensus | Back alignment and domain information |
|---|
| >PRK04004 translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >cd03698 eRF3_II_like eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3) | Back alignment and domain information |
|---|
| >COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd03693 EF1_alpha_II EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >PRK14845 translation initiation factor IF-2; Provisional | Back alignment and domain information |
|---|
| >TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 | Back alignment and domain information |
|---|
| >cd04089 eRF3_II eRF3_II: domain II of the eukaryotic class II release factor (eRF3) | Back alignment and domain information |
|---|
| >KOG0467|consensus | Back alignment and domain information |
|---|
| >cd03695 CysN_NodQ_II CysN_NodQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu | Back alignment and domain information |
|---|
| >cd03696 selB_II selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu | Back alignment and domain information |
|---|
| >cd03694 GTPBP_II Domain II of the GP-1 family of GTPase | Back alignment and domain information |
|---|
| >cd04168 TetM_like Tet(M)-like subfamily | Back alignment and domain information |
|---|
| >cd03697 EFTU_II EFTU_II: Elongation factor Tu domain II | Back alignment and domain information |
|---|
| >cd01886 EF-G Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >cd04169 RF3 RF3 subfamily | Back alignment and domain information |
|---|
| >cd03702 IF2_mtIF2_II This family represents the domain II of bacterial Initiation Factor 2 (IF2) and its eukaryotic mitochondrial homologue mtIF2 | Back alignment and domain information |
|---|
| >cd03692 mtIF2_IVc mtIF2_IVc: this family represents the C2 subdomain of domain IV of mitochondrial translation initiation factor 2 (mtIF2) which adopts a beta-barrel fold displaying a high degree of structural similarity with domain II of the translation elongation factor EF-Tu | Back alignment and domain information |
|---|
| >COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0461|consensus | Back alignment and domain information |
|---|
| >KOG0465|consensus | Back alignment and domain information |
|---|
| >cd04170 EF-G_bact Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >KOG0459|consensus | Back alignment and domain information |
|---|
| >cd03701 IF2_IF5B_II IF2_IF5B_II: This family represents the domain II of prokaryotic Initiation Factor 2 (IF2) and its archeal and eukaryotic homologue aeIF5B | Back alignment and domain information |
|---|
| >KOG0458|consensus | Back alignment and domain information |
|---|
| >COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0464|consensus | Back alignment and domain information |
|---|
| >cd03703 aeIF5B_II aeIF5B_II: This family represents the domain II of archeal and eukaryotic aeIF5B | Back alignment and domain information |
|---|
| >KOG0463|consensus | Back alignment and domain information |
|---|
| >TIGR00503 prfC peptide chain release factor 3 | Back alignment and domain information |
|---|
| >cd03688 eIF2_gamma_II eIF2_gamma_II: this subfamily represents the domain II of the gamma subunit of eukaryotic translation initiation factor 2 (eIF2-gamma) found in Eukaryota and Archaea | Back alignment and domain information |
|---|
| >PRK00741 prfC peptide chain release factor 3; Provisional | Back alignment and domain information |
|---|
| >COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK00007 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >PRK12739 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site | Back alignment and domain information |
|---|
| >TIGR00484 EF-G translation elongation factor EF-G | Back alignment and domain information |
|---|
| >KOG1143|consensus | Back alignment and domain information |
|---|
| >PF14578 GTP_EFTU_D4: Elongation factor Tu domain 4; PDB: 1G7R_A 1G7S_A 1G7T_A 1XE1_A | Back alignment and domain information |
|---|
| >PF14492 EFG_II: Elongation Factor G, domain II; PDB: 1WDT_A 2DY1_A 2XEX_A 1ELO_A 2XSY_Y 2WRK_Y 1DAR_A 2WRI_Y 2XUY_Y 3J0E_H | Back alignment and domain information |
|---|
| >PRK13351 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >PRK07560 elongation factor EF-2; Reviewed | Back alignment and domain information |
|---|
| >PTZ00416 elongation factor 2; Provisional | Back alignment and domain information |
|---|
| >TIGR00490 aEF-2 translation elongation factor aEF-2 | Back alignment and domain information |
|---|
| >PLN00116 translation elongation factor EF-2 subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12740 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >cd03690 Tet_II Tet_II: This subfamily represents domain II of ribosomal protection proteins Tet(M) and Tet(O) | Back alignment and domain information |
|---|
| >COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00487 IF-2 translation initiation factor IF-2 | Back alignment and domain information |
|---|
| >PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways | Back alignment and domain information |
|---|
| >KOG0466|consensus | Back alignment and domain information |
|---|
| >cd01889 SelB_euk SelB subfamily | Back alignment and domain information |
|---|
| >CHL00189 infB translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >PRK05306 infB translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >cd00881 GTP_translation_factor GTP translation factor family | Back alignment and domain information |
|---|
| >cd04091 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes | Back alignment and domain information |
|---|
| >cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) | Back alignment and domain information |
|---|
| >cd04092 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes | Back alignment and domain information |
|---|
| >cd01890 LepA LepA subfamily | Back alignment and domain information |
|---|
| >COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd04088 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes | Back alignment and domain information |
|---|
| >cd03699 lepA_II lepA_II: This subfamily represents the domain II of LepA, a GTP-binding protein localized in the cytoplasmic membrane | Back alignment and domain information |
|---|
| >PRK10218 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd04165 GTPBP1_like GTPBP1-like | Back alignment and domain information |
|---|
| >cd01884 EF_Tu EF-Tu subfamily | Back alignment and domain information |
|---|
| >cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily | Back alignment and domain information |
|---|
| >KOG1144|consensus | Back alignment and domain information |
|---|
| >TIGR00436 era GTP-binding protein Era | Back alignment and domain information |
|---|
| >TIGR01393 lepA GTP-binding protein LepA | Back alignment and domain information |
|---|
| >TIGR01394 TypA_BipA GTP-binding protein TypA/BipA | Back alignment and domain information |
|---|
| >PRK15467 ethanolamine utilization protein EutP; Provisional | Back alignment and domain information |
|---|
| >cd01885 EF2 EF2 (for archaea and eukarya) | Back alignment and domain information |
|---|
| >cd04139 RalA_RalB RalA/RalB subfamily | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05433 GTP-binding protein LepA; Provisional | Back alignment and domain information |
|---|
| >cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans | Back alignment and domain information |
|---|
| >cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily | Back alignment and domain information |
|---|
| >cd03689 RF3_II RF3_II: this subfamily represents the domain II of bacterial Release Factor 3 (RF3) | Back alignment and domain information |
|---|
| >cd04136 Rap_like Rap-like subfamily | Back alignment and domain information |
|---|
| >cd04147 Ras_dva Ras-dva subfamily | Back alignment and domain information |
|---|
| >smart00173 RAS Ras subfamily of RAS small GTPases | Back alignment and domain information |
|---|
| >TIGR02528 EutP ethanolamine utilization protein, EutP | Back alignment and domain information |
|---|
| >cd04157 Arl6 Arl6 subfamily | Back alignment and domain information |
|---|
| >cd01860 Rab5_related Rab5-related subfamily | Back alignment and domain information |
|---|
| >TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 | Back alignment and domain information |
|---|
| >PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions | Back alignment and domain information |
|---|
| >cd04116 Rab9 Rab9 subfamily | Back alignment and domain information |
|---|
| >cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily | Back alignment and domain information |
|---|
| >cd01865 Rab3 Rab3 subfamily | Back alignment and domain information |
|---|
| >cd04160 Arfrp1 Arfrp1 subfamily | Back alignment and domain information |
|---|
| >cd03691 BipA_TypA_II BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu | Back alignment and domain information |
|---|
| >cd01862 Rab7 Rab7 subfamily | Back alignment and domain information |
|---|
| >cd04154 Arl2 Arl2 subfamily | Back alignment and domain information |
|---|
| >cd04175 Rap1 Rap1 subgroup | Back alignment and domain information |
|---|
| >cd01863 Rab18 Rab18 subfamily | Back alignment and domain information |
|---|
| >cd00880 Era_like Era (E | Back alignment and domain information |
|---|
| >PRK04004 translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >cd04151 Arl1 Arl1 subfamily | Back alignment and domain information |
|---|
| >cd04106 Rab23_lke Rab23-like subfamily | Back alignment and domain information |
|---|
| >cd04177 RSR1 RSR1 subgroup | Back alignment and domain information |
|---|
| >cd04158 ARD1 ARD1 subfamily | Back alignment and domain information |
|---|
| >cd04156 ARLTS1 ARLTS1 subfamily | Back alignment and domain information |
|---|
| >cd01855 YqeH YqeH | Back alignment and domain information |
|---|
| >cd04143 Rhes_like Rhes_like subfamily | Back alignment and domain information |
|---|
| >cd04107 Rab32_Rab38 Rab38/Rab32 subfamily | Back alignment and domain information |
|---|
| >cd04119 RJL RJL (RabJ-Like) subfamily | Back alignment and domain information |
|---|
| >cd01864 Rab19 Rab19 subfamily | Back alignment and domain information |
|---|
| >cd00876 Ras Ras family | Back alignment and domain information |
|---|
| >cd04090 eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C terminal domain:eEF2_C_snRNP: This family includes C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p | Back alignment and domain information |
|---|
| >cd04150 Arf1_5_like Arf1-Arf5-like subfamily | Back alignment and domain information |
|---|
| >cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily | Back alignment and domain information |
|---|
| >cd03700 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfamily represents domain II of elongation factor (EF) EF-2 found eukaryotes and archaea and, the C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p | Back alignment and domain information |
|---|
| >cd00879 Sar1 Sar1 subfamily | Back alignment and domain information |
|---|
| >cd04153 Arl5_Arl8 Arl5/Arl8 subfamily | Back alignment and domain information |
|---|
| >cd04113 Rab4 Rab4 subfamily | Back alignment and domain information |
|---|
| >cd04155 Arl3 Arl3 subfamily | Back alignment and domain information |
|---|
| >cd01859 MJ1464 MJ1464 | Back alignment and domain information |
|---|
| >TIGR02729 Obg_CgtA Obg family GTPase CgtA | Back alignment and domain information |
|---|
| >COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >smart00175 RAB Rab subfamily of small GTPases | Back alignment and domain information |
|---|
| >PRK00089 era GTPase Era; Reviewed | Back alignment and domain information |
|---|
| >cd01898 Obg Obg subfamily | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >cd04152 Arl4_Arl7 Arl4/Arl7 subfamily | Back alignment and domain information |
|---|
| >cd04149 Arf6 Arf6 subfamily | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >PRK04213 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd04159 Arl10_like Arl10-like subfamily | Back alignment and domain information |
|---|
| >cd01861 Rab6 Rab6 subfamily | Back alignment and domain information |
|---|
| >cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases | Back alignment and domain information |
|---|
| >cd04142 RRP22 RRP22 subfamily | Back alignment and domain information |
|---|
| >cd01868 Rab11_like Rab11-like | Back alignment and domain information |
|---|
| >PRK12299 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >cd04134 Rho3 Rho3 subfamily | Back alignment and domain information |
|---|
| >COG1159 Era GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd04135 Tc10 TC10 subfamily | Back alignment and domain information |
|---|
| >cd01894 EngA1 EngA1 subfamily | Back alignment and domain information |
|---|
| >cd04176 Rap2 Rap2 subgroup | Back alignment and domain information |
|---|
| >cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily | Back alignment and domain information |
|---|
| >cd00154 Rab Rab family | Back alignment and domain information |
|---|
| >cd04114 Rab30 Rab30 subfamily | Back alignment and domain information |
|---|
| >PRK15494 era GTPase Era; Provisional | Back alignment and domain information |
|---|
| >cd01870 RhoA_like RhoA-like subfamily | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >PTZ00369 Ras-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00101 ureG urease accessory protein UreG | Back alignment and domain information |
|---|
| >PRK14845 translation initiation factor IF-2; Provisional | Back alignment and domain information |
|---|
| >cd04101 RabL4 RabL4 (Rab-like4) subfamily | Back alignment and domain information |
|---|
| >cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >cd04124 RabL2 RabL2 subfamily | Back alignment and domain information |
|---|
| >cd04127 Rab27A Rab27a subfamily | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor | Back alignment and domain information |
|---|
| >cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 | Back alignment and domain information |
|---|
| >cd04110 Rab35 Rab35 subfamily | Back alignment and domain information |
|---|
| >PTZ00133 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >PLN00223 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases | Back alignment and domain information |
|---|
| >cd04123 Rab21 Rab21 subfamily | Back alignment and domain information |
|---|
| >cd04171 SelB SelB subfamily | Back alignment and domain information |
|---|
| >PTZ00099 rab6; Provisional | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >cd00157 Rho Rho (Ras homology) family | Back alignment and domain information |
|---|
| >cd04112 Rab26 Rab26 subfamily | Back alignment and domain information |
|---|
| >PRK12298 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04140 ARHI_like ARHI subfamily | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >cd04109 Rab28 Rab28 subfamily | Back alignment and domain information |
|---|
| >PLN03110 Rab GTPase; Provisional | Back alignment and domain information |
|---|
| >cd04132 Rho4_like Rho4-like subfamily | Back alignment and domain information |
|---|
| >cd01895 EngA2 EngA2 subfamily | Back alignment and domain information |
|---|
| >cd04167 Snu114p Snu114p subfamily | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >cd04163 Era Era subfamily | Back alignment and domain information |
|---|
| >cd04125 RabA_like RabA-like subfamily | Back alignment and domain information |
|---|
| >cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily | Back alignment and domain information |
|---|
| >cd00882 Ras_like_GTPase Ras-like GTPase superfamily | Back alignment and domain information |
|---|
| >cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily | Back alignment and domain information |
|---|
| >cd01849 YlqF_related_GTPase YlqF-related GTPases | Back alignment and domain information |
|---|
| >cd04130 Wrch_1 Wrch-1 subfamily | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 221 | ||||
| 2bv3_A | 691 | Crystal Structure Of A Mutant Elongation Factor G T | 3e-20 | ||
| 3izp_E | 688 | Conformation Of Ef-G During Translocation Length = | 3e-20 | ||
| 1zn0_B | 655 | Coordinates Of Rrf And Ef-G Fitted Into Cryo-Em Map | 3e-20 | ||
| 1fnm_A | 691 | Structure Of Thermus Thermophilus Ef-G H573a Length | 3e-20 | ||
| 1ktv_A | 691 | Crystal Structure Of Elongation Factor G Dimer With | 3e-20 | ||
| 1efg_A | 691 | The Crystal Structure Of Elongation Factor G Comple | 3e-20 | ||
| 2j7k_A | 691 | Crystal Structure Of The T84a Mutant Ef-G:gdpcp Com | 3e-20 | ||
| 2bm0_A | 691 | Ribosomal Elongation Factor G (Ef-G) Fusidic Acid R | 3e-20 | ||
| 2bm1_A | 691 | Ribosomal Elongation Factor G (Ef-G) Fusidic Acid R | 3e-20 | ||
| 3zzu_A | 693 | Crystal Structure Of Staphylococcus Aureus Elongati | 6e-19 | ||
| 3zzt_A | 693 | Crystal Structure Of Staphylococcus Aureus Elongati | 6e-19 | ||
| 3zz0_A | 693 | Crystal Structure Of Ribosomal Elongation Factor (E | 6e-19 | ||
| 2xex_A | 693 | Crystal Structure Of Staphylococcus Aureus Elongati | 6e-19 | ||
| 4fn5_A | 709 | Elongation Factor G 1 (Pseudomonas Aeruginosa) In C | 2e-18 | ||
| 3j0e_H | 702 | Models For The T. Thermophilus Ribosome Recycling F | 1e-17 | ||
| 2rdo_7 | 704 | 50s Subunit With Ef-G(Gdpnp) And Rrf Bound Length = | 1e-17 | ||
| 3tr5_A | 528 | Structure Of A Peptide Chain Release Factor 3 (Prfc | 2e-08 | ||
| 1wdt_A | 665 | Crystal Structure Of Ttk003000868 From Thermus Ther | 3e-08 | ||
| 3vqt_A | 548 | Crystal Structure Analysis Of The Translation Facto | 2e-07 | ||
| 2h5e_A | 529 | Crystal Structure Of E.Coli Polypeptide Release Fac | 3e-07 | ||
| 3uoq_W | 534 | Crystal Structure Of Release Factor Rf3 Trapped In | 3e-07 | ||
| 2ywe_A | 600 | Crystal Structure Of Lepa From Aquifex Aeolicus Len | 7e-06 | ||
| 2ywg_A | 600 | Crystal Structure Of Gtp-Bound Lepa From Aquifex Ae | 2e-05 | ||
| 3j25_A | 638 | Structural Basis For Tetm-Mediated Tetracycline Res | 8e-04 |
| >pdb|2BV3|A Chain A, Crystal Structure Of A Mutant Elongation Factor G Trapped With A Gtp Analogue Length = 691 | Back alignment and structure |
|
| >pdb|3IZP|E Chain E, Conformation Of Ef-G During Translocation Length = 688 | Back alignment and structure |
| >pdb|1ZN0|B Chain B, Coordinates Of Rrf And Ef-G Fitted Into Cryo-Em Map Of The 50s Subunit Bound With Both Ef-G (Gdpnp) And Rrf Length = 655 | Back alignment and structure |
| >pdb|1FNM|A Chain A, Structure Of Thermus Thermophilus Ef-G H573a Length = 691 | Back alignment and structure |
| >pdb|1KTV|A Chain A, Crystal Structure Of Elongation Factor G Dimer Without Nucleotide Length = 691 | Back alignment and structure |
| >pdb|1EFG|A Chain A, The Crystal Structure Of Elongation Factor G Complexed With Gdp, At 2.7 Angstroms Resolution Length = 691 | Back alignment and structure |
| >pdb|2J7K|A Chain A, Crystal Structure Of The T84a Mutant Ef-G:gdpcp Complex Length = 691 | Back alignment and structure |
| >pdb|2BM0|A Chain A, Ribosomal Elongation Factor G (Ef-G) Fusidic Acid Resistant Mutant T84a Length = 691 | Back alignment and structure |
| >pdb|2BM1|A Chain A, Ribosomal Elongation Factor G (Ef-G) Fusidic Acid Resistant Mutant G16v Length = 691 | Back alignment and structure |
| >pdb|3ZZU|A Chain A, Crystal Structure Of Staphylococcus Aureus Elongation Factor G With Mutations M16i And F88l Length = 693 | Back alignment and structure |
| >pdb|3ZZT|A Chain A, Crystal Structure Of Staphylococcus Aureus Elongation Factor G With A Fusidic-Acid-Resistant Mutation F88l Length = 693 | Back alignment and structure |
| >pdb|3ZZ0|A Chain A, Crystal Structure Of Ribosomal Elongation Factor (Ef)-G From Staphylococcus Aureus With A Fusidic Acid Hyper-Sensitivity Mutation M16i Length = 693 | Back alignment and structure |
| >pdb|2XEX|A Chain A, Crystal Structure Of Staphylococcus Aureus Elongation Factor G Length = 693 | Back alignment and structure |
| >pdb|4FN5|A Chain A, Elongation Factor G 1 (Pseudomonas Aeruginosa) In Complex With Argyrin B Length = 709 | Back alignment and structure |
| >pdb|3J0E|H Chain H, Models For The T. Thermophilus Ribosome Recycling Factor And The E. Coli Elongation Factor G Bound To The E. Coli Post-Termination Complex Length = 702 | Back alignment and structure |
| >pdb|2RDO|7 Chain 7, 50s Subunit With Ef-G(Gdpnp) And Rrf Bound Length = 704 | Back alignment and structure |
| >pdb|3TR5|A Chain A, Structure Of A Peptide Chain Release Factor 3 (Prfc) From Coxiella Burnetii Length = 528 | Back alignment and structure |
| >pdb|1WDT|A Chain A, Crystal Structure Of Ttk003000868 From Thermus Thermophilus Hb8 Length = 665 | Back alignment and structure |
| >pdb|3VQT|A Chain A, Crystal Structure Analysis Of The Translation Factor Rf3 Length = 548 | Back alignment and structure |
| >pdb|2H5E|A Chain A, Crystal Structure Of E.Coli Polypeptide Release Factor Rf3 Length = 529 | Back alignment and structure |
| >pdb|3UOQ|W Chain W, Crystal Structure Of Release Factor Rf3 Trapped In The Gtp State On A Rotated Conformation Of The Ribosome (Without Viomycin) Length = 534 | Back alignment and structure |
| >pdb|2YWE|A Chain A, Crystal Structure Of Lepa From Aquifex Aeolicus Length = 600 | Back alignment and structure |
| >pdb|2YWG|A Chain A, Crystal Structure Of Gtp-Bound Lepa From Aquifex Aeolicus Length = 600 | Back alignment and structure |
| >pdb|3J25|A Chain A, Structural Basis For Tetm-Mediated Tetracycline Resistance Length = 638 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 221 | |||
| 2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 8e-36 | |
| 2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 7e-11 | |
| 2xex_A | 693 | Elongation factor G; GTPase, translation, biosynth | 1e-34 | |
| 2xex_A | 693 | Elongation factor G; GTPase, translation, biosynth | 1e-09 | |
| 1dar_A | 691 | EF-G, elongation factor G; ribosomal translocase, | 1e-34 | |
| 1dar_A | 691 | EF-G, elongation factor G; ribosomal translocase, | 1e-09 | |
| 2rdo_7 | 704 | EF-G, elongation factor G; elongation factor G, EF | 2e-34 | |
| 2rdo_7 | 704 | EF-G, elongation factor G; elongation factor G, EF | 1e-09 | |
| 1n0u_A | 842 | EF-2, elongation factor 2; G-protein, CIS-proline, | 1e-13 | |
| 3tr5_A | 528 | RF-3, peptide chain release factor 3; protein synt | 7e-09 | |
| 2h5e_A | 529 | Peptide chain release factor RF-3; beta barrel, tr | 9e-09 | |
| 2ywe_A | 600 | GTP-binding protein LEPA; G domain, beta-barrel, f | 1e-06 | |
| 3cb4_D | 599 | GTP-binding protein LEPA; GTPase, OB-fold, membran | 2e-06 | |
| 1wb1_A | 482 | Translation elongation factor SELB; selenocysteine | 2e-04 |
| >2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Length = 665 | Back alignment and structure |
|---|
Score = 132 bits (334), Expect = 8e-36
Identities = 34/116 (29%), Positives = 49/116 (42%), Gaps = 9/116 (7%)
Query: 58 VPVLCGSSYKNIGVQKLMDAIVDILPSPTERPALAMFQHFGDSLCARAFKVVHDKHRGAV 117
PV S + IGV L++ I++ LPSPTER A+ FKV D G V
Sbjct: 248 YPVALASGEREIGVLPLLELILEALPSPTERFGDGPP-------LAKVFKVQVDPFMGQV 300
Query: 118 TFFRIYSGAFKKGQKFYNIHLDQSEQITRLLLAEADDYKEVNEIQCGNIAAVTGLK 173
+ R+Y G K G + ++ L + D EV E + G + V +
Sbjct: 301 AYLRLYRGRLKPGDSLQS--EAGQVRLPHLYVPMGKDLLEVEEAEAGFVLGVPKAE 354
|
| >2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Length = 665 | Back alignment and structure |
|---|
| >2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Length = 693 | Back alignment and structure |
|---|
| >2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Length = 693 | Back alignment and structure |
|---|
| >1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Length = 691 | Back alignment and structure |
|---|
| >1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Length = 691 | Back alignment and structure |
|---|
| >2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Length = 704 | Back alignment and structure |
|---|
| >2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Length = 704 | Back alignment and structure |
|---|
| >1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Length = 842 | Back alignment and structure |
|---|
| >3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Length = 528 | Back alignment and structure |
|---|
| >2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Length = 529 | Back alignment and structure |
|---|
| >2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Length = 600 | Back alignment and structure |
|---|
| >3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Length = 599 | Back alignment and structure |
|---|
| >1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Length = 482 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 221 | |||
| 2xex_A | 693 | Elongation factor G; GTPase, translation, biosynth | 100.0 | |
| 2rdo_7 | 704 | EF-G, elongation factor G; elongation factor G, EF | 100.0 | |
| 1dar_A | 691 | EF-G, elongation factor G; ribosomal translocase, | 100.0 | |
| 4fn5_A | 709 | EF-G 1, elongation factor G 1; translation, transl | 99.98 | |
| 3vqt_A | 548 | RF-3, peptide chain release factor 3; translation, | 99.98 | |
| 3tr5_A | 528 | RF-3, peptide chain release factor 3; protein synt | 99.97 | |
| 2h5e_A | 529 | Peptide chain release factor RF-3; beta barrel, tr | 99.97 | |
| 2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 99.96 | |
| 3j25_A | 638 | Tetracycline resistance protein TETM; antibiotic r | 99.95 | |
| 1n0u_A | 842 | EF-2, elongation factor 2; G-protein, CIS-proline, | 99.93 | |
| 2ywe_A | 600 | GTP-binding protein LEPA; G domain, beta-barrel, f | 99.93 | |
| 3cb4_D | 599 | GTP-binding protein LEPA; GTPase, OB-fold, membran | 99.91 | |
| 1g7s_A | 594 | Translation initiation factor IF2/EIF5B; translati | 99.73 | |
| 2c78_A | 405 | Elongation factor TU-A; hydrolase, GTPase, transla | 99.66 | |
| 1d2e_A | 397 | Elongation factor TU (EF-TU); G-protein, beta-barr | 99.63 | |
| 1jny_A | 435 | EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- | 99.55 | |
| 2elf_A | 370 | Protein translation elongation factor 1A; tRNA, py | 99.54 | |
| 1kk1_A | 410 | EIF2gamma; initiation of translation; HET: GNP; 1. | 99.53 | |
| 3sjy_A | 403 | Translation initiation factor 2 subunit gamma; zin | 99.52 | |
| 3j2k_7 | 439 | ERF3, eukaryotic polypeptide chain release factor | 99.51 | |
| 3p26_A | 483 | Elongation factor 1 alpha-like protein; GTP/GDP bi | 99.51 | |
| 1s0u_A | 408 | EIF-2-gamma, translation initiation factor 2 gamma | 99.51 | |
| 3avx_A | 1289 | Elongation factor TS, elongation factor TU, linke | 99.5 | |
| 3mca_A | 592 | HBS1, elongation factor 1 alpha-like protein; prot | 99.49 | |
| 3izy_P | 537 | Translation initiation factor IF-2, mitochondrial; | 99.45 | |
| 3izq_1 | 611 | HBS1P, elongation factor 1 alpha-like protein; NO- | 99.45 | |
| 1r5b_A | 467 | Eukaryotic peptide chain release factor GTP-bindi | 99.36 | |
| 1f60_A | 458 | Elongation factor EEF1A; protein-protein complex, | 99.35 | |
| 1zo1_I | 501 | IF2, translation initiation factor 2; E. coli, rib | 99.35 | |
| 1zun_B | 434 | Sulfate adenylate transferase, subunit 1/adenylyls | 99.34 | |
| 1wb1_A | 482 | Translation elongation factor SELB; selenocysteine | 99.23 | |
| 3e1y_E | 204 | Eukaryotic peptide chain release factor GTP-bindi | 98.87 | |
| 1xe1_A | 116 | Hypothetical protein PF0907; structural genomics, | 97.69 | |
| 3vqt_A | 548 | RF-3, peptide chain release factor 3; translation, | 97.5 | |
| 4fn5_A | 709 | EF-G 1, elongation factor G 1; translation, transl | 97.31 | |
| 2rdo_7 | 704 | EF-G, elongation factor G; elongation factor G, EF | 97.17 | |
| 1dar_A | 691 | EF-G, elongation factor G; ribosomal translocase, | 97.15 | |
| 2xex_A | 693 | Elongation factor G; GTPase, translation, biosynth | 97.08 | |
| 3tr5_A | 528 | RF-3, peptide chain release factor 3; protein synt | 96.98 | |
| 1d1n_A | 99 | Initiation factor 2; beta-barrel, gene regulation; | 96.83 | |
| 1n0u_A | 842 | EF-2, elongation factor 2; G-protein, CIS-proline, | 96.76 | |
| 3qq5_A | 423 | Small GTP-binding protein; hydrogenase, H-cluster, | 96.76 | |
| 2crv_A | 120 | IF-2MT, translation initiation factor IF-2; riboso | 96.5 | |
| 2h5e_A | 529 | Peptide chain release factor RF-3; beta barrel, tr | 96.27 | |
| 3j25_A | 638 | Tetracycline resistance protein TETM; antibiotic r | 96.21 | |
| 1zo1_I | 501 | IF2, translation initiation factor 2; E. coli, rib | 95.2 | |
| 3izy_P | 537 | Translation initiation factor IF-2, mitochondrial; | 94.7 | |
| 2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 94.38 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 94.17 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 93.94 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 93.38 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 93.34 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 93.24 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 93.23 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 93.09 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 93.04 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 93.04 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 92.91 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 92.79 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 92.72 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 92.7 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 92.69 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 92.66 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 92.63 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 92.61 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 92.6 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 92.57 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 92.55 | |
| 1g7s_A | 594 | Translation initiation factor IF2/EIF5B; translati | 92.5 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 92.29 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 91.9 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 91.89 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 91.81 | |
| 2atx_A | 194 | Small GTP binding protein TC10; GTPase, P-loop, al | 91.81 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 91.75 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 91.7 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 91.63 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 91.59 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 91.5 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 91.27 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 91.21 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 91.07 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 91.03 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 91.02 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 90.99 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 90.95 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 90.88 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 90.87 | |
| 4bas_A | 199 | ADP-ribosylation factor, putative (small GTPase, p | 90.87 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 90.84 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 90.69 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 90.68 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 90.67 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 90.65 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 90.63 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 90.63 | |
| 2x77_A | 189 | ADP-ribosylation factor; GTP-binding protein, smal | 90.51 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 90.49 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 90.48 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 90.39 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 90.34 | |
| 4djt_A | 218 | GTP-binding nuclear protein GSP1; structural genom | 89.99 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 89.96 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 89.94 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 89.9 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 89.83 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 89.82 | |
| 4he6_A | 89 | Peptidase family U32; ultra-tight crystal packing, | 89.8 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 89.79 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 89.79 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 89.68 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 89.68 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 89.66 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 89.58 | |
| 2q3h_A | 201 | RAS homolog gene family, member U; GTPase, structu | 89.53 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 89.53 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 89.45 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 89.37 | |
| 3i8s_A | 274 | Ferrous iron transport protein B; GTPase, GPCR, ir | 89.33 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 89.22 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 89.11 | |
| 2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 88.99 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 88.83 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 88.74 | |
| 3l0i_B | 199 | RAS-related protein RAB-1A; GEF-GDF-RAB complex, G | 88.51 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 88.37 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 88.33 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 88.31 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 88.3 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 88.3 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 88.09 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 88.08 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 87.9 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 87.74 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 87.67 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 87.66 | |
| 2f7s_A | 217 | C25KG, RAS-related protein RAB-27B; G-protein, str | 87.62 | |
| 1wf3_A | 301 | GTP-binding protein; GTPase, riken structural geno | 87.28 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 87.16 | |
| 2wkq_A | 332 | NPH1-1, RAS-related C3 botulinum toxin substrate 1 | 87.11 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 86.95 | |
| 2j0v_A | 212 | RAC-like GTP-binding protein ARAC7; nucleotide-bin | 86.76 | |
| 3a1s_A | 258 | Iron(II) transport protein B; FEOB, iron transport | 86.65 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 86.35 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 86.25 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 86.23 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 86.22 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 86.14 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 85.78 | |
| 3th5_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 85.87 | |
| 3cb4_D | 599 | GTP-binding protein LEPA; GTPase, OB-fold, membran | 85.61 | |
| 3iby_A | 256 | Ferrous iron transport protein B; G protein, G dom | 85.48 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 85.4 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 85.26 | |
| 1lnz_A | 342 | SPO0B-associated GTP-binding protein; GTPase, OBG, | 85.01 | |
| 2ywe_A | 600 | GTP-binding protein LEPA; G domain, beta-barrel, f | 84.98 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 84.76 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 84.73 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 84.71 | |
| 3cpj_B | 223 | GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl | 84.45 | |
| 4dkx_A | 216 | RAS-related protein RAB-6A; GTP binding fold, memb | 84.33 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 84.28 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 84.25 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 83.65 | |
| 3b1v_A | 272 | Ferrous iron uptake transporter protein B; G prote | 82.99 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 82.77 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 82.66 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 82.31 | |
| 2yc2_C | 208 | IFT27, small RAB-related GTPase; transport protein | 82.11 | |
| 2cjw_A | 192 | GTP-binding protein GEM; nucleotide-binding, small | 81.99 | |
| 3e3x_A | 332 | BIPA; MCSG,PSI2, structural genomics, protein stru | 81.97 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 81.53 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 80.27 | |
| 3gee_A | 476 | MNME, tRNA modification GTPase MNME; G protein, cy | 80.2 | |
| 3c5h_A | 255 | Glucocorticoid receptor DNA-binding factor 1; RAS, | 80.12 |
| >2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
Probab=100.00 E-value=4e-34 Score=272.35 Aligned_cols=193 Identities=27% Similarity=0.406 Sum_probs=162.6
Q ss_pred CCCceeeeeeeecccccCCcchHHHHhhccccccCceeEecCCCccccHHHHHHHHHhhCCCCCCcccc-----------
Q psy5461 23 FGDSLCARAFKVVHDKHRGAVTFFRIYSGAFKKNHVPVLCGSSYKNIGVQKLMDAIVDILPSPTERPAL----------- 91 (221)
Q Consensus 23 ~~~~~~~~vfk~~~d~~~g~l~~~~l~~~~~~~~~~Pv~~gSa~~~~Gi~~LLd~I~~~~PsP~~~~~~----------- 91 (221)
.|+.+...++. .+....+.....+++++.++..+|||+|||++|.|+++|||+|++++|+|.+++..
T Consensus 221 ~dd~l~e~~l~--~~~~~~~~~~~~l~~~~~~~~~~Pv~~gSA~~~~Gv~~LLd~i~~~lPsP~~~~~~~~~~~~~~~~~ 298 (693)
T 2xex_A 221 TSDELMEKYLG--DEEISVSELKEAIRQATTNVEFYPVLCGTAFKNKGVQLMLDAVIDYLPSPLDVKPIIGHRASNPEEE 298 (693)
T ss_dssp TCHHHHHHHHT--TCCCCHHHHHHHHHHHHHTTSCEEEEECBTTTTBSHHHHHHHHHHHSCCGGGSCCEEEEETTEEEEE
T ss_pred CCHHHHHHHhc--CCCCCHHHHHHHHHHHHHhCCeeeEEEeecccCcCHHHHHHHHHHHCCCchhcccccccCCCccccc
Confidence 34455555444 12222333455677788888999999999999999999999999999999875331
Q ss_pred -cccCCCCCCcEEEEEEEeecCCCceEEEEEEEceEEcCCCEEEeccCCceeeeceeEeeecCCeeeeCccccCCEEEEc
Q psy5461 92 -AMFQHFGDSLCARAFKVVHDKHRGAVTFFRIYSGAFKKGQKFYNIHLDQSEQITRLLLAEADDYKEVNEIQCGNIAAVT 170 (221)
Q Consensus 92 -~~~~~~~~~~~~~Vfk~~~d~~~G~i~~~RV~sG~L~~gd~v~~~~~~~~~~v~~i~~~~g~~~~~v~~a~aGdIv~i~ 170 (221)
.+.|++++||+|+|||+.+|+++|+++|+|||||+|++||+|++.+++++++|++|+.++|+++++++++.||||+++.
T Consensus 299 ~~~~~~~~~p~~a~VfK~~~d~~~g~~~~~RV~sG~l~~g~~v~~~~~~~~~~v~~l~~~~g~~~~~v~~~~aGdI~~i~ 378 (693)
T 2xex_A 299 VIAKADDSAEFAALAFKVMTDPYVGKLTFFRVYSGTMTSGSYVKNSTKGKRERVGRLLQMHANSRQEIDTVYSGDIAAAV 378 (693)
T ss_dssp EEECSCTTSCCEEEEEEEEEETTTEEEEEEEEEESEEETTEEEEETTTTEEEEECCEEEECSSCEEECSEEETTCEEEEE
T ss_pred eeecCCCCCceEEEEEEeeecCCCceEEEEEEEeeeEecCCEEEecCCCceEEeceEEEEeCCCceEccccCcCCEEEEe
Confidence 2356778999999999999999999999999999999999999999898999999999999999999999999999999
Q ss_pred CCCCCccCcEEecCC--------CCCCCce----------ehHHHHHHHHHHhhcCCceEEEccc
Q psy5461 171 GLKRERGKDKRTRVI--------PKPTSVV----------QCSARWTLNLEVGASSPIISKSKRR 217 (221)
Q Consensus 171 gl~~~~~Gdtl~~~~--------~~p~~~v----------~~~~l~~~L~~L~~~Dp~l~~~~~~ 217 (221)
|++++++||||++.. ..|.|++ |.++|.+||++|+++||++++.+|.
T Consensus 379 gl~~~~~GdTl~~~~~~~~~~~~~~~~Pv~~~av~p~~~~d~~kl~~~L~~l~~eDp~l~~~~~~ 443 (693)
T 2xex_A 379 GLKDTGTGDTLCGEKNDIILESMEFPEPVIHLSVEPKSKADQDKMTQALVKLQEEDPTFHAHTDE 443 (693)
T ss_dssp SCSSCCTTCEEEETTCCEECCCCSSCSCSEEEEEEESSHHHHHHHHHHHHHHHHHCTTCEEEC--
T ss_pred CcccCccCCEEecCCCccccCCcCCCCceEEEEEEeCCchhHHHHHHHHHHHHhhCCeEEEEEcC
Confidence 999999999999752 1233666 7899999999999999999999864
|
| >2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H | Back alignment and structure |
|---|
| >1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... | Back alignment and structure |
|---|
| >4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* | Back alignment and structure |
|---|
| >3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* | Back alignment and structure |
|---|
| >2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* | Back alignment and structure |
|---|
| >3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* | Back alignment and structure |
|---|
| >2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* | Back alignment and structure |
|---|
| >3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* | Back alignment and structure |
|---|
| >1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* | Back alignment and structure |
|---|
| >2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... | Back alignment and structure |
|---|
| >1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* | Back alignment and structure |
|---|
| >1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* | Back alignment and structure |
|---|
| >2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* | Back alignment and structure |
|---|
| >3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* | Back alignment and structure |
|---|
| >3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* | Back alignment and structure |
|---|
| >1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B | Back alignment and structure |
|---|
| >3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} | Back alignment and structure |
|---|
| >3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A | Back alignment and structure |
|---|
| >1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A | Back alignment and structure |
|---|
| >1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* | Back alignment and structure |
|---|
| >3e1y_E Eukaryotic peptide chain release factor GTP-bindi ERF3A; translation termination, peptide release, PTC, P biosynthesis, GTP-binding; HET: ATP; 3.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1xe1_A Hypothetical protein PF0907; structural genomics, unknown function, protein structure INI secsg, conserved hypothetical protein; HET: MSE; 2.00A {Pyrococcus furiosus} SCOP: b.43.3.1 | Back alignment and structure |
|---|
| >3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* | Back alignment and structure |
|---|
| >4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H | Back alignment and structure |
|---|
| >1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... | Back alignment and structure |
|---|
| >2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1d1n_A Initiation factor 2; beta-barrel, gene regulation; NMR {Geobacillus stearothermophilus} SCOP: b.43.3.1 | Back alignment and structure |
|---|
| >1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* | Back alignment and structure |
|---|
| >3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} | Back alignment and structure |
|---|
| >2crv_A IF-2MT, translation initiation factor IF-2; ribosome, beta barrel, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* | Back alignment and structure |
|---|
| >3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} | Back alignment and structure |
|---|
| >2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4he6_A Peptidase family U32; ultra-tight crystal packing, unknown function; 1.10A {Geobacillus thermoleovorans} PDB: 4he5_A | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* | Back alignment and structure |
|---|
| >1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* | Back alignment and structure |
|---|
| >3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C | Back alignment and structure |
|---|
| >2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* | Back alignment and structure |
|---|
| >3e3x_A BIPA; MCSG,PSI2, structural genomics, protein struct initiative, midwest center for structural genomics, GTP-BIN nucleotide-binding; HET: MLZ MLY; 1.95A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* | Back alignment and structure |
|---|
| >3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 221 | ||||
| d2bv3a1 | 121 | b.43.3.1 (A:283-403) Elongation factor G (EF-G), d | 2e-12 | |
| d2bv3a1 | 121 | b.43.3.1 (A:283-403) Elongation factor G (EF-G), d | 0.002 | |
| d2dy1a1 | 103 | b.43.3.1 (A:275-377) Elongation factor G (EF-G), d | 3e-12 | |
| d2dy1a1 | 103 | b.43.3.1 (A:275-377) Elongation factor G (EF-G), d | 4e-06 | |
| d2dy1a2 | 267 | c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-t | 4e-10 | |
| d2bv3a2 | 276 | c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-t | 1e-09 | |
| d1n0ua1 | 138 | b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), | 5e-09 |
| >d2bv3a1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]} Length = 121 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Reductase/isomerase/elongation factor common domain superfamily: Translation proteins family: Elongation factors domain: Elongation factor G (EF-G), domain II species: Thermus thermophilus [TaxId: 274]
Score = 59.7 bits (144), Expect = 2e-12
Identities = 34/98 (34%), Positives = 50/98 (51%), Gaps = 12/98 (12%)
Query: 76 DAIVDILPSPTERPALAMFQHFGDSLCARAFKVVHDKHRGAVTFFRIYSGAFKKGQKFYN 135
+V+I P P L A AFK++ D + G +TF R+YSG G YN
Sbjct: 14 GEVVEIHPDPNG------------PLAALAFKIMADPYVGRLTFIRVYSGTLTSGSYVYN 61
Query: 136 IHLDQSEQITRLLLAEADDYKEVNEIQCGNIAAVTGLK 173
+ E++ RLL A+ +EV E++ G++ AV GLK
Sbjct: 62 TTKGRKERVARLLRMHANHREEVEELKAGDLGAVVGLK 99
|
| >d2bv3a1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]} Length = 121 | Back information, alignment and structure |
|---|
| >d2dy1a1 b.43.3.1 (A:275-377) Elongation factor G (EF-G), domain II {Thermus thermophilus, EF-G-2 [TaxId: 274]} Length = 103 | Back information, alignment and structure |
|---|
| >d2dy1a1 b.43.3.1 (A:275-377) Elongation factor G (EF-G), domain II {Thermus thermophilus, EF-G-2 [TaxId: 274]} Length = 103 | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Length = 267 | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 276 | Back information, alignment and structure |
|---|
| >d1n0ua1 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 138 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 221 | |||
| d2bv3a1 | 121 | Elongation factor G (EF-G), domain II {Thermus the | 99.91 | |
| d2dy1a1 | 103 | Elongation factor G (EF-G), domain II {Thermus the | 99.88 | |
| d1n0ua1 | 138 | Elongation factor 2 (eEF-2), domain II {Baker's ye | 99.85 | |
| d1f60a1 | 94 | Elongation factor eEF-1alpha, domain 2 {Baker's ye | 99.22 | |
| d1jnya1 | 95 | Elongation factor eEF-1alpha, domain 2 {Archaeon S | 99.19 | |
| d1r5ba1 | 95 | Eukaryotic peptide chain release factor ERF2, post | 99.06 | |
| d2c78a1 | 100 | Elongation factor Tu (EF-Tu), domain 2 {Thermus th | 99.04 | |
| d1efca1 | 92 | Elongation factor Tu (EF-Tu), domain 2 {Escherichi | 99.04 | |
| d1d2ea1 | 98 | Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos t | 98.98 | |
| d1wb1a1 | 92 | Elongation factor SelB, domains 2 and 4 {Methanoco | 98.88 | |
| d1zunb1 | 92 | Sulfate adenylate transferase subunit cysN/C, EF-T | 98.84 | |
| d1xe1a_ | 91 | Hypothetical protein PF0907 {Pyrococcus furiosus [ | 98.64 | |
| d1kk1a1 | 121 | Initiation factor eIF2 gamma subunit, domain II {A | 98.62 | |
| d1s0ua1 | 118 | Initiation factor eIF2 gamma subunit, domain II {A | 98.48 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 98.42 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 98.34 | |
| d1g7sa1 | 101 | Initiation factor IF2/eIF5b, domains 2 and 4 {Arch | 98.23 | |
| d2qn6a1 | 114 | Initiation factor eIF2 gamma subunit, domain II {S | 98.12 | |
| d1g7sa2 | 128 | Initiation factor IF2/eIF5b, domains 2 and 4 {Arch | 98.1 | |
| d2bv3a1 | 121 | Elongation factor G (EF-G), domain II {Thermus the | 97.34 | |
| d2qn6a3 | 205 | Initiation factor eIF2 gamma subunit, N-terminal ( | 97.33 | |
| d2dy1a4 | 77 | Elongation factor G (EF-G) {Thermus thermophilus, | 97.24 | |
| d2bv3a4 | 75 | Elongation factor G (EF-G) {Thermus thermophilus [ | 97.2 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 97.04 | |
| d1kk1a3 | 195 | Initiation factor eIF2 gamma subunit, N-terminal ( | 96.86 | |
| d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 96.65 | |
| d1d1na_ | 99 | Initiation factor IF2/eIF5b, domains 2 and 4 {Baci | 96.63 | |
| d2dy1a1 | 103 | Elongation factor G (EF-G), domain II {Thermus the | 96.55 | |
| d1n0ua4 | 79 | Elongation factor 2 (eEF-2) {Baker's yeast (Saccha | 96.15 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 95.8 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 95.19 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 95.13 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 95.07 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 94.97 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 94.89 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 94.37 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 94.28 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 94.27 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 94.25 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 93.87 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 93.82 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 93.8 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 93.53 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 93.49 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 93.44 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 93.27 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 93.05 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 92.93 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 92.42 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 92.16 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 92.16 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 92.13 | |
| d1n0ua1 | 138 | Elongation factor 2 (eEF-2), domain II {Baker's ye | 92.03 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 91.54 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 91.25 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 91.05 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 90.34 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 90.29 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 90.05 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 89.94 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 89.34 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 89.31 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 89.26 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 89.18 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 88.96 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 88.76 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 88.69 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 88.61 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 88.27 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 88.25 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 88.09 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 87.92 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 87.8 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 87.73 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 87.36 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 87.28 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 86.94 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 86.31 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 86.24 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 86.21 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 86.06 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 85.89 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 85.63 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 85.17 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 83.44 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 82.86 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 82.75 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 82.29 |
| >d2bv3a1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Reductase/isomerase/elongation factor common domain superfamily: Translation proteins family: Elongation factors domain: Elongation factor G (EF-G), domain II species: Thermus thermophilus [TaxId: 274]
Probab=99.91 E-value=1.2e-24 Score=162.66 Aligned_cols=90 Identities=34% Similarity=0.541 Sum_probs=86.9
Q ss_pred CCCCCCcEEEEEEEeecCCCceEEEEEEEceEEcCCCEEEeccCCceeeeceeEeeecCCeeeeCccccCCEEEEcCCCC
Q psy5461 95 QHFGDSLCARAFKVVHDKHRGAVTFFRIYSGAFKKGQKFYNIHLDQSEQITRLLLAEADDYKEVNEIQCGNIAAVTGLKR 174 (221)
Q Consensus 95 ~~~~~~~~~~Vfk~~~d~~~G~i~~~RV~sG~L~~gd~v~~~~~~~~~~v~~i~~~~g~~~~~v~~a~aGdIv~i~gl~~ 174 (221)
+++++||+|+|||+++|+++|+++|+|||||+|++||+|++.+++++++|.+|+.++|.++++++++.||||+++.|+++
T Consensus 21 pd~~~p~~a~Vfk~~~d~~~G~i~~~RV~sG~l~~g~~v~~~~~~~~~rv~~l~~~~g~~~~~v~~~~aGdI~~i~gl~~ 100 (121)
T d2bv3a1 21 PDPNGPLAALAFKIMADPYVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHREEVEELKAGDLGAVVGLKE 100 (121)
T ss_dssp CCTTSCCEEEEEEEEEETTTEEEEEEEEEESEEETTEEEEETTTTEEEEECEEEEECSSCEEEESEEETTCEEEEESCSS
T ss_pred CCCCCCEEEEEEeeeecCCCCeEEeeeecccccCCCCEEEEccCCCEEEEeeeeeeecccccEeeEeccccceEEeccCC
Confidence 46789999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CccCcEEecC
Q psy5461 175 ERGKDKRTRV 184 (221)
Q Consensus 175 ~~~Gdtl~~~ 184 (221)
+++|||||+.
T Consensus 101 ~~~GDTl~~~ 110 (121)
T d2bv3a1 101 TITGDTLVGE 110 (121)
T ss_dssp CCTTCEEEET
T ss_pred ceeCCEEecC
Confidence 9999999975
|
| >d2dy1a1 b.43.3.1 (A:275-377) Elongation factor G (EF-G), domain II {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1n0ua1 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1f60a1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jnya1 b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, domain 2 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1r5ba1 b.43.3.1 (A:460-554) Eukaryotic peptide chain release factor ERF2, post-G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2c78a1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1efca1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d2ea1 b.43.3.1 (A:251-348) Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1wb1a1 b.43.3.1 (A:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1zunb1 b.43.3.1 (B:238-329) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 2-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d1xe1a_ b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1kk1a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1s0ua1 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma subunit, domain II {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g7sa1 b.43.3.1 (A:228-328) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2qn6a1 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1g7sa2 b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2bv3a1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2dy1a4 d.58.11.1 (A:378-454) Elongation factor G (EF-G) {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bv3a4 d.58.11.1 (A:404-478) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1d1na_ b.43.3.1 (A:) Initiation factor IF2/eIF5b, domains 2 and 4 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2dy1a1 b.43.3.1 (A:275-377) Elongation factor G (EF-G), domain II {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1n0ua4 d.58.11.1 (A:482-560) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1n0ua1 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|