Diaphorina citri psyllid: psy5464


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-
MQVDHFGPIAVKWDPKNLEIRTMSVEKTLEPLVLQVTTLVNTKGPSKKKKGRSKRAHVLVAAVEKATENFIERGDAMSLAAREFADDPCSSLKRGNMVRAARNLLSAVTRLLILADMVDVHLLLKSLRVVEDDLEKVKNASSQGELLDNIKAFGRNATELMAQAAKHGAEGSSATQGELLDNIKAFGRNATELMAQAAKRQMELKDPQLRDDLAAARAILKKHSTMLLTASKVYVRHPELAAAKENRNFVLGTTGFFTLAVTSLKKRSVSLLHQVYERMVMDPLAYNERVRPSLEERLESIISGAALMADSNCTRDDRRERIVAECNAVRQALQDLLSEYMANMSIKDPSEGLERAIDHMCRKTRDLRRQLRKAVVDHERMVMDPLAYNERVRPSLEERLESIISGAALMADSNCTRDDRRERIVAECNAVRQALQDLLSDFMETDIPILVLIEAARSGNEKEVEKAAENFADHANKLVEE
cccccccccccccccccccEEEEEHHHHccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcc
*****FGPIAVKWDPKNLEIRTMSVEKTLEPLVLQVTTLV*****************VLVAAVEKATENFIERGDAMSLA***F*******LKRGNMVRAARNLLSAVTRLLILADMVDVHLLLKSLRVVEDDLEKVKNASSQGELLDNIKAFGRNATELMAQAAKHGAEGSSATQGELLDNIKAFGRNATELMAQAAKRQMELKDPQLRDDLAAARAILKKHSTMLLTASKVYVRHPELAAAKENRNFVLGTTGFFTLAVTSLKKRSVSLLHQVYERMVMDPLAYNERVRPSL**RLESIISGAALMADSNCTRDDRRERIVAECNAVRQALQDLLSEYMAN*************IDHMCRKTRDLRRQLRKAVVDHERMVMDPLAYNERVRPSLEERL*SIISGAALMADSNCTRDDRRERIVAECNAVRQALQDLLSDFMETDIPILVLIEA*************ENFADHANKL***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQVDHFGPIAVKWDPKNLEIRTMSVEKTLEPLVLQVTTLVNTKGPSKKKKGRSKRAHVLVAAVEKATENFIERGDAMSLAAREFADDPCSSLKRGNMVRAARNLLSAVTRLLILADMVDVHLLLKSLRVVEDDLEKVKNASSQGELLDNIKAFGRNATELMAQAAKHGAEGSSATQGELLDNIKAFGRNATELMAQAAKRQMELKDPQLRDDLAAARAILKKHSTMLLTASKVYVRHPELAAAKENRNFVLGTTGFFTLAVTSLKKRSVSLLHQVYERMVMDPLAYNERVRPSLEERLESIISGAALMADSNCTRDDRRERIVAECNAVRQALQDLLSEYMANMSIKDPSEGLERAIDHMCRKTRDLRRQLRKAVVDHERMVMDPLAYNERVRPSLEERLESIISGAALMADSNCTRDDRRERIVAECNAVRQALQDLLSDFMETDIPILVLIEAARSGNEKEVEKAAENFADHANKLVEE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Catenin alpha-1 Associates with the cytoplasmic domain of a variety of cadherins. The association of catenins to cadherins produces a complex which is linked to the actin filament network, and which seems to be of primary importance for cadherins cell-adhesion properties. Can associate with both E- and N-cadherins. Originally believed to be a stable component of E-cadherin/catenin adhesion complexes and to mediate the linkage of cadherins to the actin cytoskeleton at adherens junctions. In contrast, cortical actin was found to be much more dynamic than E-cadherin/catenin complexes and CTNNA1 was shown not to bind to F-actin when assembled in the complex suggesting a different linkage between actin and adherens junctions components. The homodimeric form may regulate actin filament assembly and inhibit actin branching by competing with the Arp2/3 complex for binding to actin filaments. May play a crucial role in cell differentiation.confidentP26231
Catenin alpha-1 Associates with the cytoplasmic domain of a variety of cadherins. The association of catenins to cadherins produces a complex which is linked to the actin filament network, and which seems to be of primary importance for cadherins cell-adhesion properties. Can associate with both E- and N-cadherins. Originally believed to be a stable component of E-cadherin/catenin adhesion complexes and to mediate the linkage of cadherins to the actin cytoskeleton at adherens junctions. In contrast, cortical actin was found to be much more dynamic than E-cadherin/catenin complexes and CTNNA1 was shown not to bind to F-actin when assembled in the complex suggesting a different linkage between actin and adherens junctions components. The homodimeric form may regulate actin filament assembly and inhibit actin branching by competing with the Arp2/3 complex for binding to actin filaments. May play a crucial role in cell differentiation.confidentQ3MHM6
Catenin alpha Associates with the cytoplasmic domain of a variety of cadherins. The association of catenins to cadherins produces a complex which is linked to the actin filament network, and which seems to be of primary importance for cadherins cell-adhesion properties. Can associate with the armadillo protein.confidentP35220

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0007155 [BP]cell adhesionprobableGO:0008150, GO:0009987, GO:0022610, GO:0044763, GO:0044699
GO:0043229 [CC]intracellular organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0043226
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0005913 [CC]cell-cell adherens junctionprobableGO:0005575, GO:0030054, GO:0070161, GO:0005912, GO:0005911
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0014704 [CC]intercalated discprobableGO:0005575, GO:0044291, GO:0030054, GO:0005911
GO:0030027 [CC]lamellipodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0031252, GO:0005623
GO:0048856 [BP]anatomical structure developmentprobableGO:0032502, GO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4EHP, chain B
Confidence level:very confident
Coverage over the Query: 280-371
View the alignment between query and template
View the model in PyMOL
Template: 4IGG, chain A
Confidence level:very confident
Coverage over the Query: 61-154,188-379,411-412,441-480
View the alignment between query and template
View the model in PyMOL
Template: 1TR2, chain A
Confidence level:very confident
Coverage over the Query: 19-154,188-331
View the alignment between query and template
View the model in PyMOL
Template: 4EHP, chain B
Confidence level:very confident
Coverage over the Query: 382-445
View the alignment between query and template
View the model in PyMOL
Template: 2X0C, chain A
Confidence level:probable
Coverage over the Query: 58-113,133-232
View the alignment between query and template
View the model in PyMOL