Diaphorina citri psyllid: psy5492

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-

MLPFRNREIDGALHSLSCEGAQAVLGGMSHHSDENMLIASSDSFWEPGNYKRTTKRIEDGYKLCNDLIALIQERADIEKAYAKSLKGWNKKWNELIEKVMRTCWQKDTYHKTVLHIKERKEMEDAFKKAQKPWCKLLTKVNKTKNDYHVACKAERSASNQERNASADSSLSMDQLKKMQDRVQKAKEEVQKAKEKYELALQELNSYNPKYMEDMSVVFDKCQEMETTRLQFFKDSLFSIHKCLNISQDPTVLHIKERKEMEDAFKKAQKPWCKTVLHIKERKEMEDAFKKAQKPWCIMQHLKLICILKCCYSRLPQIYEEFYHTINNADHEKDLKWWSNNHGVNMAMNWPQFEVRLSYHSP

cccccccccccccccccccccccccccccccccccHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHHccccccccccccEEEEEccccc

******************************************SFWEPGNYKRTTKRIEDGYKLCNDLIALIQERADIEKAYAKSLKGWNKKWNELIEKVMRTCWQKDTYHKTVLHIKERKEMEDAFKKAQKPWCKLLTKVNKTKNDYHVAC********************************************YELALQELNSYNPKYMEDMSVVFDKCQEMETTRLQFFKDSLFSIHKCLNISQDPTVLHIKERKEMEDAFKKAQKPWCKTVLHIKERKEMEDAFKKAQKPWCIMQHLKLICILKCCYSRLPQIYEEFYHTINNADHEKDLKWWSNNHGVNMAMNWPQFEVRLS*H**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MLPFRNREIDGALHSLSCEGAQAVLGGMSHHSDENMLIASSDSFWEPGNYKRTTKRIEDGYKLCNDLIALIQERADIEKAYAKSLKGWNKKWNELIEKVMRTCWQKDTYHKTVLHIKERKEMEDAFKKAQKPWCKLLTKVNKTKNDYHVACKAERSASNQERNASADxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNPKYMEDMSVVFDKCQEMETTRLQFFKDSLFSIHKCLNISQDPTVLHIKERKEMEDAFKKAQKPWCKTVLHIKERKEMEDAFKKAQKPWCIMQHLKLICILKCCYSRLPQIYEEFYHTINNADHEKDLKWWSNNHGVNMAMNWPQFEVRLSYHSP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0008092 [MF]	cytoskeletal protein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005802 [CC]	trans-Golgi network	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0045806 [BP]	negative regulation of endocytosis	probable	GO:0032879, GO:0051051, GO:0050794, GO:0051049, GO:0009987, GO:0051129, GO:0060627, GO:0008150, GO:0065007, GO:0044763, GO:0044699, GO:0048519, GO:0051128, GO:0030100, GO:0050789, GO:0048523

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3I2W, chain A
Confidence level:very confident
Coverage over the Query: 41-158,179-249,313-355
View the alignment between query and template
View the model in PyMOL

Template: 3ACO, chain A
Confidence level:very confident
Coverage over the Query: 44-249,313-350
View the alignment between query and template
View the model in PyMOL

Template: 4DYL, chain A
Confidence level:confident
Coverage over the Query: 267-298
View the alignment between query and template
View the model in PyMOL