Diaphorina citri psyllid: psy5514


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120----
MFAQYTVNVYGSCKQLHITQLFKIGHTEVGTLGVCRYLGCLGVSRYLRKLFGIEEGISQISKHTAGCPQFVWNFPIEIVFKSNNPHGWPQLILCVYGLDGFGNDVIRGYGLCHLPISSGTTAKQ
ccEEEEccccccEEEEEEEEEEEEECccccccCEEEEEEEEccccEEEEccccEEEEEEEEEccccccEEEEEccEEEEEECcccccccEEEEEEEECcccccCEEEEEEEEEEcccccCEECc
**AQYTVNVYGSCKQLHITQLFKIGHTEVGTLGVCRYLGCLGVSRYLRKLFGIEEGISQISKHTAGCPQFVWNFPIEIVFKSNNPHGWPQLILCVYGLDGFGNDVIRGYGLCHLPIS*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFAQYTVNVYGSCKQLHITQLFKIGHTEVGTLGVCRYLGCLGVSRYLRKLFGIEEGISQISKHTAGCPQFVWNFPIEIVFKSNNPHGWPQLILCVYGLDGFGNDVIRGYGLCHLPISSGTTAKQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
B9 domain-containing protein 1 Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. Required for ciliogenesis and sonic hedgehog/SHH signaling.confidentQ9R1S0
B9 domain-containing protein 1 Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. Required for ciliogenesis and sonic hedgehog/SHH signaling.confidentP0C5J2
B9 domain-containing protein 1 Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. Required for ciliogenesis and sonic hedgehog/SHH signaling.confidentQ9UPM9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016020 [CC]membraneprobableGO:0005575
GO:0005932 [CC]microtubule basal bodyprobableGO:0005856, GO:0005575, GO:0015630, GO:0043228, GO:0005622, GO:0043232, GO:0044463, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0042995, GO:0043226, GO:0044422
GO:0036038 [CC]TCTN-B9D complexprobableGO:0043234, GO:0035869, GO:0044463, GO:0032991, GO:0005575, GO:0031514, GO:0044441, GO:0044464, GO:0005623, GO:0031513, GO:0044446, GO:0043229, GO:0072372, GO:0005622, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BWQ, chain A
Confidence level:probable
Coverage over the Query: 20-116
View the alignment between query and template
View the model in PyMOL