Diaphorina citri psyllid: psy5526


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
MSLPEELGPALSDGVVLCHLANHVRPRSVASIHVPSPAVPKLTMARCRRNVDNFLEACRKIGVEEGDLCDRDSIVDATQGSLSTLSNT
ccccHHHHHHcccHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccc
*SLPEELGPALSDGVVLCHLANHVRPRSVASIHVPSPAVPKLTMARCRRNVDNFLEACRKIGVEEGDLCDRDSIVDATQGSLSTL***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLPEELGPALSDGVVLCHLANHVRPRSVASIHVPSPAVPKLTMARCRRNVDNFLEACRKIGVEEGDLCDRDSIVDATQGSLSTLSNT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Leucine-rich repeat and calponin homology domain-containing protein 1 confidentP62046
Leucine-rich repeat and calponin homology domain-containing protein 1 confidentQ9Y2L9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0032154 [CC]cleavage furrowprobableGO:0005575, GO:0044464, GO:0032153, GO:0032155, GO:0005623
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0016605 [CC]PML bodyprobableGO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0008150 [BP]biological_processprobable

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1H67, chain A
Confidence level:very confident
Coverage over the Query: 2-81
View the alignment between query and template
View the model in PyMOL