Psyllid ID: psy5526


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
MSLPEELGPALSDGVVLCHLANHVRPRSVASIHVPSPAVPKLTMARCRRNVDNFLEACRKIGVEEGDLCDRDSIVDATQGSLSTLSNT
ccccHHHHHHcccHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccc
ccccHHHHHHHHccEEEHHHHHccccccccEEEccccccccccHHHHHHHHHHHHHHHHHccccHHHccccHHHHcccccccEEEEEc
mslpeelgpalsdGVVLCHLanhvrprsvasihvpspavpkltmaRCRRNVDNFLEACRKIGVeegdlcdrdsivdatqgslstlsnt
mslpeelgpALSDGVVLCHLANHVrprsvasihvpspavpkltmarCRRNVDNFLEACRKIGVeegdlcdrdsivdatqgslstlsnt
MSLPEELGPALSDGVVLCHLANHVRPRSVASIHVPSPAVPKLTMARCRRNVDNFLEACRKIGVEEGDLCDRDSIVDATQGSLSTLSNT
***********SDGVVLCHLANHVRPRSVASIHVPSPAVPKLTMARCRRNVDNFLEACRKIGVEEGDLCDRDSI**************
*SLPEELGPALSDGVVLCHLANHVRPRS****************ARCRRNVDNFLEACRKIGVEEGDLCDRDSIVDATQGSLSTL***
MSLPEELGPALSDGVVLCHLANHVRPRSVASIHVPSPAVPKLTMARCRRNVDNFLEACRKIGVEEGDLCDRDSIVDATQG********
MSLPEELGPALSDGVVLCHLANHVRPRSVASIHVPSPAVPKLTMARCRRNVDNFLEACRKIGVEEGDLCDRDSIVDATQGSLSTLSNT
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooo
ooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLPEELGPALSDGVVLCHLANHVRPRSVASIHVPSPAVPKLTMARCRRNVDNFLEACRKIGVEEGDLCDRDSIVDATQGSLSTLSNT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query88 2.2.26 [Sep-21-2011]
Q9Y2L9728 Leucine-rich repeat and c yes N/A 0.784 0.094 0.811 6e-28
Q96II8777 Leucine-rich repeat and c no N/A 0.784 0.088 0.826 2e-27
P62046709 Leucine-rich repeat and c yes N/A 0.784 0.097 0.811 3e-27
Q8BVU0778 Leucine-rich repeat and c no N/A 0.784 0.088 0.811 4e-27
P41737251 Leucine-rich repeat and c N/A N/A 0.784 0.274 0.797 5e-27
Q3UMG5773 Leucine-rich repeat and c no N/A 0.761 0.086 0.761 3e-26
Q5VUJ6765 Leucine-rich repeat and c no N/A 0.761 0.087 0.761 3e-26
Q921G6680 Leucine-rich repeat and c no N/A 0.943 0.122 0.578 6e-22
O75427683 Leucine-rich repeat and c no N/A 0.931 0.120 0.585 7e-22
>sp|Q9Y2L9|LRCH1_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Homo sapiens GN=LRCH1 PE=1 SV=3 Back     alignment and function desciption
 Score =  122 bits (306), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 63/69 (91%)

Query: 1   MSLPEELGPALSDGVVLCHLANHVRPRSVASIHVPSPAVPKLTMARCRRNVDNFLEACRK 60
           +SL E+LG AL DGVVLCHL NH+RPRSVASIHVPSPAVPKL+MA+CRRNV+NFLEACRK
Sbjct: 596 VSLHEDLGAALMDGVVLCHLVNHIRPRSVASIHVPSPAVPKLSMAKCRRNVENFLEACRK 655

Query: 61  IGVEEGDLC 69
           +GV E DLC
Sbjct: 656 LGVPEADLC 664





Homo sapiens (taxid: 9606)
>sp|Q96II8|LRCH3_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Homo sapiens GN=LRCH3 PE=1 SV=2 Back     alignment and function description
>sp|P62046|LRCH1_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Mus musculus GN=Lrch1 PE=1 SV=2 Back     alignment and function description
>sp|Q8BVU0|LRCH3_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Mus musculus GN=Lrch3 PE=2 SV=3 Back     alignment and function description
>sp|P41737|LRCH1_FELCA Leucine-rich repeat and calponin homology domain-containing protein 1 (Fragment) OS=Felis catus PE=2 SV=2 Back     alignment and function description
>sp|Q3UMG5|LRCH2_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Mus musculus GN=Lrch2 PE=2 SV=2 Back     alignment and function description
>sp|Q5VUJ6|LRCH2_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens GN=LRCH2 PE=2 SV=2 Back     alignment and function description
>sp|Q921G6|LRCH4_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Mus musculus GN=Lrch4 PE=2 SV=1 Back     alignment and function description
>sp|O75427|LRCH4_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens GN=LRCH4 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query88
307213439 724 Leucine-rich repeat and calponin-like pr 0.863 0.104 0.868 1e-31
340709272 826 PREDICTED: hypothetical protein LOC10064 0.863 0.092 0.855 2e-31
357620537 804 hypothetical protein KGM_05636 [Danaus p 0.886 0.097 0.807 5e-31
270007220 716 hypothetical protein TcasGA2_TC013766 [T 0.909 0.111 0.775 6e-31
91082255 715 PREDICTED: similar to CG6860 CG6860-PA [ 0.909 0.111 0.775 6e-31
242024056 652 calponin homology domain containing prot 0.784 0.105 0.913 7e-31
66500629 758 PREDICTED: leucine-rich repeat and calpo 0.909 0.105 0.775 7e-30
350425067 757 PREDICTED: leucine-rich repeat and calpo 0.909 0.105 0.775 7e-30
380012198 730 PREDICTED: leucine-rich repeat and calpo 0.909 0.109 0.775 7e-30
383865043 756 PREDICTED: leucine-rich repeat and calpo 0.909 0.105 0.775 8e-30
>gi|307213439|gb|EFN88861.1| Leucine-rich repeat and calponin-like proteiny domain-containing protein 3 [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 66/76 (86%), Positives = 71/76 (93%)

Query: 1   MSLPEELGPALSDGVVLCHLANHVRPRSVASIHVPSPAVPKLTMARCRRNVDNFLEACRK 60
           M+LPE+L PAL+DGVVLCHLANHVRPRSVASIHVPSPAVPKLTMARCRRNVDNFLEACRK
Sbjct: 543 MALPEDLAPALTDGVVLCHLANHVRPRSVASIHVPSPAVPKLTMARCRRNVDNFLEACRK 602

Query: 61  IGVEEGDLCDRDSIVD 76
           IGV+E  L D DSI+D
Sbjct: 603 IGVDEEVLLDADSIMD 618




Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|340709272|ref|XP_003393235.1| PREDICTED: hypothetical protein LOC100649436 [Bombus terrestris] Back     alignment and taxonomy information
>gi|357620537|gb|EHJ72690.1| hypothetical protein KGM_05636 [Danaus plexippus] Back     alignment and taxonomy information
>gi|270007220|gb|EFA03668.1| hypothetical protein TcasGA2_TC013766 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91082255|ref|XP_973064.1| PREDICTED: similar to CG6860 CG6860-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242024056|ref|XP_002432446.1| calponin homology domain containing protein, putative [Pediculus humanus corporis] gi|212517879|gb|EEB19708.1| calponin homology domain containing protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|66500629|ref|XP_392557.2| PREDICTED: leucine-rich repeat and calponin homology domain-containing protein 1-like [Apis mellifera] Back     alignment and taxonomy information
>gi|350425067|ref|XP_003494001.1| PREDICTED: leucine-rich repeat and calponin homology domain-containing protein 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380012198|ref|XP_003690173.1| PREDICTED: leucine-rich repeat and calponin homology domain-containing protein 1-like [Apis florea] Back     alignment and taxonomy information
>gi|383865043|ref|XP_003707985.1| PREDICTED: leucine-rich repeat and calponin homology domain-containing protein 1-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query88
UNIPROTKB|Q96II8777 LRCH3 "Leucine-rich repeat and 0.784 0.088 0.826 8.1e-26
MGI|MGI:1917394778 Lrch3 "leucine-rich repeats an 0.784 0.088 0.811 1.7e-25
MGI|MGI:2443390709 Lrch1 "leucine-rich repeats an 0.784 0.097 0.811 1.8e-25
MGI|MGI:2147870773 Lrch2 "leucine-rich repeats an 0.761 0.086 0.761 1.6e-24
FB|FBgn0032633 1135 Lrch "Leucine-rich-repeats and 0.852 0.066 0.72 1.9e-24
UNIPROTKB|O75427683 LRCH4 "Leucine-rich repeat and 0.931 0.120 0.585 9.6e-22
RGD|1306145686 Lrch4 "leucine-rich repeats an 0.943 0.120 0.590 1.6e-21
UNIPROTKB|F1RMY1690 LRCH4 "Uncharacterized protein 0.943 0.120 0.595 4.4e-21
UNIPROTKB|F1MV58658 LRCH4 "Uncharacterized protein 0.840 0.112 0.581 2.5e-18
DICTYBASE|DDB_G0292664176 DDB_G0292664 "calponin homolog 0.636 0.318 0.444 3.9e-05
UNIPROTKB|Q96II8 LRCH3 "Leucine-rich repeat and calponin homology domain-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 302 (111.4 bits), Expect = 8.1e-26, P = 8.1e-26
 Identities = 57/69 (82%), Positives = 63/69 (91%)

Query:     1 MSLPEELGPALSDGVVLCHLANHVRPRSVASIHVPSPAVPKLTMARCRRNVDNFLEACRK 60
             +SLP +LG AL+DGVVLCHLANHVRPRSV SIHVPSPAVPKLTMA+CRRNV+NFLEACRK
Sbjct:   672 VSLPCDLGAALTDGVVLCHLANHVRPRSVPSIHVPSPAVPKLTMAKCRRNVENFLEACRK 731

Query:    61 IGVEEGDLC 69
             IGV +  LC
Sbjct:   732 IGVPQEQLC 740




GO:0005576 "extracellular region" evidence=IEA
MGI|MGI:1917394 Lrch3 "leucine-rich repeats and calponin homology (CH) domain containing 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
MGI|MGI:2443390 Lrch1 "leucine-rich repeats and calponin homology (CH) domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
MGI|MGI:2147870 Lrch2 "leucine-rich repeats and calponin homology (CH) domain containing 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0032633 Lrch "Leucine-rich-repeats and calponin homology domain protein" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|O75427 LRCH4 "Leucine-rich repeat and calponin homology domain-containing protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1306145 Lrch4 "leucine-rich repeats and calponin homology (CH) domain containing 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RMY1 LRCH4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MV58 LRCH4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0292664 DDB_G0292664 "calponin homology (CH) domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9Y2L9LRCH1_HUMANNo assigned EC number0.81150.78400.0947yesN/A
P62046LRCH1_MOUSENo assigned EC number0.81150.78400.0973yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query88
smart00033101 smart00033, CH, Calponin homology domain 7e-13
cd00014107 cd00014, CH, Calponin homology domain; actin-bindi 2e-09
pfam00307104 pfam00307, CH, Calponin homology (CH) domain 6e-07
>gnl|CDD|214479 smart00033, CH, Calponin homology domain Back     alignment and domain information
 Score = 58.1 bits (141), Expect = 7e-13
 Identities = 18/67 (26%), Positives = 29/67 (43%), Gaps = 5/67 (7%)

Query: 10 ALSDGVVLCHLANHVRPRSVASIHVPSPAVPKLTMARCRRNVDNFLEACRKIGVEEGDLC 69
           L DGV LC L N + P  V    V       L+  +   N++  L    K+G +   L 
Sbjct: 25 DLKDGVALCALLNSLSPGLVDKKKVA----ASLSRFKKIENINLALSFAEKLGGKV-VLF 79

Query: 70 DRDSIVD 76
          + + +V+
Sbjct: 80 EPEDLVE 86


Actin binding domains present in duplicate at the N-termini of spectrin-like proteins (including dystrophin, alpha-actinin). These domains cross-link actin filaments into bundles and networks. A calponin homology domain is predicted in yeasst Cdc24p. Length = 101

>gnl|CDD|237981 cd00014, CH, Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) Back     alignment and domain information
>gnl|CDD|215849 pfam00307, CH, Calponin homology (CH) domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 88
KOG2046|consensus193 99.91
KOG0532|consensus722 99.83
KOG2996|consensus 865 99.74
cd00014107 CH Calponin homology domain; actin-binding domain 99.72
COG5199178 SCP1 Calponin [Cytoskeleton] 99.71
smart00033103 CH Calponin homology domain. Actin binding domains 99.65
KOG2128|consensus 1401 99.53
PF00307108 CH: Calponin homology (CH) domain; InterPro: IPR00 99.47
COG5261 1054 IQG1 Protein involved in regulation of cellular mo 99.45
PF1197185 CAMSAP_CH: CAMSAP CH domain; InterPro: IPR022613 T 99.0
KOG0046|consensus 627 98.8
PF0639589 CDC24: CDC24 Calponin; InterPro: IPR010481 This is 98.4
COG5069 612 SAC6 Ca2+-binding actin-bundling protein fimbrin/p 97.16
KOG0517|consensus 2473 96.17
KOG0046|consensus 627 94.57
PF06294158 DUF1042: Domain of Unknown Function (DUF1042); Int 89.92
>KOG2046|consensus Back     alignment and domain information
Probab=99.91  E-value=2.8e-25  Score=152.85  Aligned_cols=74  Identities=28%  Similarity=0.447  Sum_probs=67.1

Q ss_pred             CchhhHHHHccchHHHHHHHHhhcCCCCCcccCCCCCCcchhhhHHHHHHHHHHHHHHHhCCCCCCCCCCCcccccCCCc
Q psy5526           2 SLPEELGPALSDGVVLCHLANHVRPRSVASIHVPSPAVPKLTMARCRRNVDNFLEACRKIGVEEGDLCDRDSIVDATQGS   81 (88)
Q Consensus         2 ~~~~~~~~~LrdGv~LC~L~N~l~P~~i~~I~~~~~~~~~~~~f~~~eNI~~FL~~c~~~Gv~~~~lF~~~DL~e~kn~~   81 (88)
                      +++++|.+.|+||++||+|+|+|+|+++++++.+.      ..|.+||||+.|+++|+.+||++.++|+++||||+||+.
T Consensus        43 ~~~~~f~~~LKDG~iLCkl~N~l~p~~~~~~~~s~------~~f~qmEnIs~Fi~a~~~ygv~~~d~FqtvDLfE~kd~~  116 (193)
T KOG2046|consen   43 PARGDFQDLLKDGVILCKLINKLYPGVVKKINESK------MAFVQMENISNFIKAAKKYGVPEVDLFQTVDLFEGKDMA  116 (193)
T ss_pred             CcccCHHHHHcchHHHHHHHHHhCcCccccccccc------ccHHHHHHHHHHHHHHHhcCCChhhcccccccccCCCHH
Confidence            46789999999999999999999998777777543      269999999999999999999999999999999999964



>KOG0532|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>cd00014 CH Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) Back     alignment and domain information
>COG5199 SCP1 Calponin [Cytoskeleton] Back     alignment and domain information
>smart00033 CH Calponin homology domain Back     alignment and domain information
>KOG2128|consensus Back     alignment and domain information
>PF00307 CH: Calponin homology (CH) domain; InterPro: IPR001715 The calponin homology domain (also known as CH-domain) is a superfamily of actin-binding domains found in both cytoskeletal proteins and signal transduction proteins [] Back     alignment and domain information
>COG5261 IQG1 Protein involved in regulation of cellular morphogenesis/cytokinesis [Cell division and chromosome partitioning / Signal transduction mechanisms] Back     alignment and domain information
>PF11971 CAMSAP_CH: CAMSAP CH domain; InterPro: IPR022613 This domain is the N-terminal CH domain from calmodulin-regulated spectrin-associated proteins - CAMSAP proteins Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>PF06395 CDC24: CDC24 Calponin; InterPro: IPR010481 This is a calponin homology domain Back     alignment and domain information
>COG5069 SAC6 Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton] Back     alignment and domain information
>KOG0517|consensus Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>PF06294 DUF1042: Domain of Unknown Function (DUF1042); InterPro: IPR010441 This is a family of proteins of unknown function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query88
1h67_A108 Nmr Structure Of The Ch Domain Of Calponin Length = 1e-05
1wyp_A136 Solution Structure Of The Ch Domain Of Human Calpon 7e-05
1wyr_A121 Solution Structure Of The Ch Domain Of Human Rho Gu 2e-04
2d86_A143 Solution Structure Of The Ch Domain From Human Vav- 6e-04
>pdb|1H67|A Chain A, Nmr Structure Of The Ch Domain Of Calponin Length = 108 Back     alignment and structure

Iteration: 1

Score = 44.7 bits (104), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 6/69 (8%) Query: 10 ALSDGVVLCHLANHVRPRSVASIHVPSPAVPKLTMARCRRNVDNFLEACRKIGVEEGDLC 69 L DGV+LC L N ++P SV ++ P KL N+ NFL A + GV+ D+ Sbjct: 27 GLKDGVILCELINKLQPGSVQKVNDPVQNWHKL------ENIGNFLRAIKHYGVKPHDIF 80 Query: 70 DRDSIVDAT 78 + + + + T Sbjct: 81 EANDLFENT 89
>pdb|1WYP|A Chain A, Solution Structure Of The Ch Domain Of Human Calponin 1 Length = 136 Back     alignment and structure
>pdb|1WYR|A Chain A, Solution Structure Of The Ch Domain Of Human Rho Guanine Nucleotide Exchange Factor 6 Length = 121 Back     alignment and structure
>pdb|2D86|A Chain A, Solution Structure Of The Ch Domain From Human Vav-3 Protein Length = 143 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query88
1h67_A108 Calponin alpha; cytoskeleton, calponin homology do 3e-21
1p2x_A159 RNG2 protein, RAS GTPase-activating-like protein; 4e-18
1wyp_A136 Calponin 1; CH domain, F-actin binding, all-alpha, 5e-18
1ujo_A144 Transgelin; CH domain, actin binding, structural g 2e-17
2rr8_A190 Iqgap1 protein; F-actin binding protein, protein b 7e-17
1p5s_A203 RAS GTPase-activating-like protein RNG2; alpha-hel 1e-16
3i6x_A193 P195, RAS GTPase-activating-like protein iqgap1; a 1e-16
1wym_A155 Transgelin-2; CH domain, F-actin binding, all heli 4e-16
1wyn_A146 Calponin-2; CH domain, F-actin binding, all alpha 1e-15
1wyr_A121 RHO guanine nucleotide exchange factor 6; CH domai 2e-14
2l3g_A126 RHO guanine nucleotide exchange factor 7; structur 5e-13
3ky9_A 587 Proto-oncogene VAV; calponin homology domain, DBL 3e-09
>1h67_A Calponin alpha; cytoskeleton, calponin homology domain, actin binding,; NMR {Gallus gallus} SCOP: a.40.1.1 Length = 108 Back     alignment and structure
 Score = 79.4 bits (196), Expect = 3e-21
 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 6/79 (7%)

Query: 1  MSLPEELGPALSDGVVLCHLANHVRPRSVASIHVPSPAVPKLTMARCRRNVDNFLEACRK 60
            + +     L DGV+LC L N ++P SV  ++ P              N+ NFL A + 
Sbjct: 18 RRIGDNFMDGLKDGVILCELINKLQPGSVQKVNDPVQN------WHKLENIGNFLRAIKH 71

Query: 61 IGVEEGDLCDRDSIVDATQ 79
           GV+  D+ + + + + T 
Sbjct: 72 YGVKPHDIFEANDLFENTN 90


>1p2x_A RNG2 protein, RAS GTPase-activating-like protein; helices, bundle, protein binding; 2.21A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 159 Back     alignment and structure
>1wyp_A Calponin 1; CH domain, F-actin binding, all-alpha, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 136 Back     alignment and structure
>1ujo_A Transgelin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: a.40.1.1 Length = 144 Back     alignment and structure
>2rr8_A Iqgap1 protein; F-actin binding protein, protein binding; NMR {Homo sapiens} Length = 190 Back     alignment and structure
>1p5s_A RAS GTPase-activating-like protein RNG2; alpha-helical bundle, cytokine; 2.22A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 203 Back     alignment and structure
>3i6x_A P195, RAS GTPase-activating-like protein iqgap1; all helical, calmodulin-binding, cell membrane, membrane, phosphoprotein, protein binding; 2.50A {Homo sapiens} Length = 193 Back     alignment and structure
>1wym_A Transgelin-2; CH domain, F-actin binding, all helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1wyn_A Calponin-2; CH domain, F-actin binding, all alpha helix, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 146 Back     alignment and structure
>1wyr_A RHO guanine nucleotide exchange factor 6; CH domain, all-alpha, NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2l3g_A RHO guanine nucleotide exchange factor 7; structural genomics, northeast structural genomics consortiu PSI-biology, calponin-homology domain; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Length = 587 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query88
1h67_A108 Calponin alpha; cytoskeleton, calponin homology do 99.96
1wyp_A136 Calponin 1; CH domain, F-actin binding, all-alpha, 99.95
1wyn_A146 Calponin-2; CH domain, F-actin binding, all alpha 99.95
1ujo_A144 Transgelin; CH domain, actin binding, structural g 99.95
1wym_A155 Transgelin-2; CH domain, F-actin binding, all heli 99.94
1p2x_A159 RNG2 protein, RAS GTPase-activating-like protein; 99.94
1p5s_A203 RAS GTPase-activating-like protein RNG2; alpha-hel 99.93
2rr8_A190 Iqgap1 protein; F-actin binding protein, protein b 99.93
3i6x_A193 P195, RAS GTPase-activating-like protein iqgap1; a 99.93
2l3g_A126 RHO guanine nucleotide exchange factor 7; structur 99.93
1wyr_A121 RHO guanine nucleotide exchange factor 6; CH domai 99.92
3ky9_A 587 Proto-oncogene VAV; calponin homology domain, DBL 99.86
2yrn_A129 Neuron navigator 2 isoform 4; calponin homolgy dom 99.55
1pxy_A 506 Fimbrin-like protein; calponin homology, F-actin-b 99.52
1aoa_A 275 T-fimbrin; actin-binding protein, calcium-binding, 99.38
1rt8_A 513 Fimbrin; filamentous actin binding domain (ABD), c 99.34
1wku_A 254 Alpha-actinin 3; calponin homology domain, actin b 99.32
2wa7_A 245 Filamin-B; disease mutation, skeletal dysplasia, s 99.24
2qjz_A123 Microtubule-associated protein RP/EB family member 99.19
1sh5_A 245 Plectin 1, PLTN, PCN; actin-binding domain, calpon 99.15
1dxx_A 246 Dystrophin; structural protein, muscular dystrophy 99.15
1wyo_A159 Protein EB3, microtubule-associated protein RP/EB 99.14
1rt8_A 513 Fimbrin; filamentous actin binding domain (ABD), c 99.08
3f7p_A 296 Plectin-1; plakin, hemidesmosome, cell adhesion, e 98.96
3hoc_A 272 Filamin-A; calponin homology domain, actin binding 98.89
2vzc_A131 Alpha-parvin; membrane, cytoplasm, cytoskeleton, c 98.85
1sjj_A 863 Actinin; 3-helix bundle, calponin homology domain, 98.83
1pxy_A 506 Fimbrin-like protein; calponin homology, F-actin-b 98.65
4b7l_A 347 Filamin-B; structural protein, FR 1 filamin hinge 98.38
1wjo_A124 T-plastin; CH domain, actin binding, structural ge 98.36
2d89_A119 EHBP1 protein; all alpha, calponin homology domain 97.77
2d87_A128 Smoothelin splice isoform L2; all alpha, calponin 97.71
2d88_A121 Protein mical-3; all alpha, calponin homology doma 97.64
1wyq_A127 Spectrin beta chain, brain 2; NPPSFA, structural g 97.64
1bkr_A109 Spectrin beta chain; filamentous actin-binding dom 97.61
1wyl_A116 NEDD9 interacting protein with calponin homology a 97.59
1wku_A254 Alpha-actinin 3; calponin homology domain, actin b 97.54
2wa7_A245 Filamin-B; disease mutation, skeletal dysplasia, s 97.39
1aoa_A275 T-fimbrin; actin-binding protein, calcium-binding, 97.3
1bhd_A118 Utrophin; calponin homology, actin binding, struct 97.29
3hoc_A272 Filamin-A; calponin homology domain, actin binding 97.22
1sh5_A245 Plectin 1, PLTN, PCN; actin-binding domain, calpon 97.14
4b7l_A 347 Filamin-B; structural protein, FR 1 filamin hinge 97.11
1dxx_A246 Dystrophin; structural protein, muscular dystrophy 97.02
3f7p_A296 Plectin-1; plakin, hemidesmosome, cell adhesion, e 96.62
2r8u_A 268 Microtubule-associated protein RP/EB family member 96.54
1sjj_A 863 Actinin; 3-helix bundle, calponin homology domain, 96.48
4abo_I145 MAL3, microtubule integrity protein MAL3; structur 95.53
2qjx_A127 Protein BIM1; calponin homology domain, protein bi 94.43
2ee7_A127 Sperm flagellar protein 1; all alpha protein, CH d 87.89
1wix_A164 HOOK homolog 1, RSGI RUH-026; structural genomics, 84.09
>1h67_A Calponin alpha; cytoskeleton, calponin homology domain, actin binding,; NMR {Gallus gallus} SCOP: a.40.1.1 Back     alignment and structure
Probab=99.96  E-value=4.4e-30  Score=162.28  Aligned_cols=74  Identities=28%  Similarity=0.530  Sum_probs=68.5

Q ss_pred             CchhhHHHHccchHHHHHHHHhhcCCCCCcccCCCCCCcchhhhHHHHHHHHHHHHHHHhCCCCCCCCCCCcccccCCCc
Q psy5526           2 SLPEELGPALSDGVVLCHLANHVRPRSVASIHVPSPAVPKLTMARCRRNVDNFLEACRKIGVEEGDLCDRDSIVDATQGS   81 (88)
Q Consensus         2 ~~~~~~~~~LrdGv~LC~L~N~l~P~~i~~I~~~~~~~~~~~~f~~~eNI~~FL~~c~~~Gv~~~~lF~~~DL~e~kn~~   81 (88)
                      ++|++|+++||||++||+|+|+++|++|++|+.+.      ..|+++|||+.||+||+++|+|+.++|++.||||+||++
T Consensus        19 ~~~~~l~~~L~dGvvLCkL~N~l~P~~v~ki~~~~------~~f~~~eNI~~Fl~a~~~~Gv~~~~lF~~~DL~e~kn~~   92 (108)
T 1h67_A           19 RIGDNFMDGLKDGVILCELINKLQPGSVQKVNDPV------QNWHKLENIGNFLRAIKHYGVKPHDIFEANDLFENTNHT   92 (108)
T ss_dssp             CCCSCHHHHHHHCSHHHHHHHHHSTTSSTTCCCTT------SSHHHHHHHHHHHHHHHHHTSCGGGSCCHHHHHHTCCSH
T ss_pred             CCcHHHHHHHccHHHHHHHHHHhCCCCcccccccc------cchHHHHHHHHHHHHHHHcCCCcccccChhHHHhCCChH
Confidence            46789999999999999999999999999998642      369999999999999999999999999999999999964



>1wyp_A Calponin 1; CH domain, F-actin binding, all-alpha, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1wyn_A Calponin-2; CH domain, F-actin binding, all alpha helix, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1ujo_A Transgelin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: a.40.1.1 Back     alignment and structure
>1wym_A Transgelin-2; CH domain, F-actin binding, all helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p2x_A RNG2 protein, RAS GTPase-activating-like protein; helices, bundle, protein binding; 2.21A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>1p5s_A RAS GTPase-activating-like protein RNG2; alpha-helical bundle, cytokine; 2.22A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>2rr8_A Iqgap1 protein; F-actin binding protein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>3i6x_A P195, RAS GTPase-activating-like protein iqgap1; all helical, calmodulin-binding, cell membrane, membrane, phosphoprotein, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>2l3g_A RHO guanine nucleotide exchange factor 7; structural genomics, northeast structural genomics consortiu PSI-biology, calponin-homology domain; NMR {Homo sapiens} Back     alignment and structure
>1wyr_A RHO guanine nucleotide exchange factor 6; CH domain, all-alpha, NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>2yrn_A Neuron navigator 2 isoform 4; calponin homolgy domain, helicase, all alpha, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Back     alignment and structure
>2qjz_A Microtubule-associated protein RP/EB family member 1; calponin homology domain, microtubule plus END, +TIP, protein binding; 1.25A {Homo sapiens} SCOP: a.40.1.1 PDB: 1pa7_A 1ueg_A 3co1_A 1v5k_A Back     alignment and structure
>1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Back     alignment and structure
>1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Back     alignment and structure
>1wyo_A Protein EB3, microtubule-associated protein RP/EB family member 3; CH domain, microtubule-binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A Back     alignment and structure
>2vzc_A Alpha-parvin; membrane, cytoplasm, cytoskeleton, cell junction, alternative splicing, calponin homology domain, actin-binding, cell membrane; 1.05A {Homo sapiens} PDB: 2vzd_A* 2vzg_B* 2vzi_B* 2k2r_A 3kmu_B 3kmw_B* 3rep_B* Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Back     alignment and structure
>4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A Back     alignment and structure
>1wjo_A T-plastin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: a.40.1.1 PDB: 2d85_A Back     alignment and structure
>2d89_A EHBP1 protein; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d87_A Smoothelin splice isoform L2; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2jv9_A 2k3s_A Back     alignment and structure
>2d88_A Protein mical-3; all alpha, calponin homology domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2e9k_A Back     alignment and structure
>1wyq_A Spectrin beta chain, brain 2; NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1bkr_A Spectrin beta chain; filamentous actin-binding domain, cytoskeleton; 1.10A {Homo sapiens} SCOP: a.40.1.1 PDB: 1aa2_A Back     alignment and structure
>1wyl_A NEDD9 interacting protein with calponin homology and LIM domains; CH domain, mical, structural genomics; NMR {Homo sapiens} PDB: 2dk9_A Back     alignment and structure
>1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Back     alignment and structure
>1bhd_A Utrophin; calponin homology, actin binding, structural protein; 2.00A {Homo sapiens} SCOP: a.40.1.1 Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A Back     alignment and structure
>1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Back     alignment and structure
>4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A Back     alignment and structure
>1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Back     alignment and structure
>3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} Back     alignment and structure
>2r8u_A Microtubule-associated protein RP/EB family member 1; cytoskeleton, acetylation, cell cycle, cell division, cytoplasm, mitosis, phosphorylation; 1.35A {Homo sapiens} SCOP: a.40.1.1 PDB: 1vka_A 1txq_B 1wu9_A 2hkq_A 2hl5_A 3tq7_A 3gjo_A 1yib_A 1yig_A Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>4abo_I MAL3, microtubule integrity protein MAL3; structural protein, cytoskeleton, GTPase, END binding; HET: GTP GSP; 8.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2qjx_A Protein BIM1; calponin homology domain, protein binding; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2ee7_A Sperm flagellar protein 1; all alpha protein, CH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wix_A HOOK homolog 1, RSGI RUH-026; structural genomics, mouse cDNA, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.40.3.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 88
d1h67a_108 a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [T 1e-16
d1ujoa_144 a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [Ta 2e-15
d1p2xa_159 a.40.1.1 (A:) Ras GTPase-activating-like protein r 4e-13
d1dxxa1111 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens 0.002
d1aoaa2116 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-cros 0.002
d1sh5a1120 a.40.1.1 (A:8-127) Actin binding domain of plectin 0.003
d1pxya_ 500 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 0.004
>d1h67a_ a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 108 Back     information, alignment and structure

class: All alpha proteins
fold: CH domain-like
superfamily: Calponin-homology domain, CH-domain
family: Calponin-homology domain, CH-domain
domain: Calponin
species: Chicken (Gallus gallus) [TaxId: 9031]
 Score = 66.1 bits (161), Expect = 1e-16
 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 2  SLPEELGPALSDGVVLCHLANHVRPRSVASIHVPSPAVPKLTMARCRRNVDNFLEACRKI 61
           + +     L DGV+LC L N ++P SV  ++ P              N+ NFL A +  
Sbjct: 19 RIGDNFMDGLKDGVILCELINKLQPGSVQKVNDPV------QNWHKLENIGNFLRAIKHY 72

Query: 62 GVEEGDLCDRDSIVDATQ 79
          GV+  D+ + + + + T 
Sbjct: 73 GVKPHDIFEANDLFENTN 90


>d1ujoa_ a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [TaxId: 10090]} Length = 144 Back     information, alignment and structure
>d1p2xa_ a.40.1.1 (A:) Ras GTPase-activating-like protein rng2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 159 Back     information, alignment and structure
>d1dxxa1 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1aoaa2 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1sh5a1 a.40.1.1 (A:8-127) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 500 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query88
d1h67a_108 Calponin {Chicken (Gallus gallus) [TaxId: 9031]} 99.96
d1ujoa_144 Transgelin {Mouse (Mus musculus) [TaxId: 10090]} 99.95
d1p2xa_159 Ras GTPase-activating-like protein rng2 {Fission y 99.89
d1aoaa1131 Fimbrin (Plastin), actin-crosslinking domain {Huma 99.18
d1wjoa_124 Fimbrin (Plastin), actin-crosslinking domain {Huma 98.79
d1sh5a1120 Actin binding domain of plectin {Human (Homo sapie 98.79
d1aoaa2116 Fimbrin (Plastin), actin-crosslinking domain {Huma 98.73
d1dxxa1111 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 98.66
d1pxya_ 500 Fimbrin (Plastin), actin-crosslinking domain {Thal 98.64
d1rt8a_ 505 Fimbrin (Plastin), actin-crosslinking domain {Fiss 98.37
d1rt8a_ 505 Fimbrin (Plastin), actin-crosslinking domain {Fiss 98.21
d1pxya_ 500 Fimbrin (Plastin), actin-crosslinking domain {Thal 98.17
d2qjza1120 Microtubule-associated protein eb1, N-terminal mic 97.97
d1dxxa2127 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 97.71
d1sh5a2110 Actin binding domain of plectin {Human (Homo sapie 97.67
d1bkra_108 beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} 97.66
d1bhda_108 Utrophin {Human (Homo sapiens) [TaxId: 9606]} 97.57
d1wixa_164 Hook homolog 1, Hook1 {Mouse (Mus musculus) [TaxId 84.21
d1hx8a1133 AP180 (Lap) {Fruit fly (Drosophila melanogaster) [ 84.18
d1hf8a1132 Clathrin assembly lymphoid myeloid leukaemia prote 83.77
>d1h67a_ a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
class: All alpha proteins
fold: CH domain-like
superfamily: Calponin-homology domain, CH-domain
family: Calponin-homology domain, CH-domain
domain: Calponin
species: Chicken (Gallus gallus) [TaxId: 9031]
Probab=99.96  E-value=1.4e-30  Score=163.49  Aligned_cols=74  Identities=28%  Similarity=0.530  Sum_probs=69.1

Q ss_pred             CchhhHHHHccchHHHHHHHHhhcCCCCCcccCCCCCCcchhhhHHHHHHHHHHHHHHHhCCCCCCCCCCCcccccCCCc
Q psy5526           2 SLPEELGPALSDGVVLCHLANHVRPRSVASIHVPSPAVPKLTMARCRRNVDNFLEACRKIGVEEGDLCDRDSIVDATQGS   81 (88)
Q Consensus         2 ~~~~~~~~~LrdGv~LC~L~N~l~P~~i~~I~~~~~~~~~~~~f~~~eNI~~FL~~c~~~Gv~~~~lF~~~DL~e~kn~~   81 (88)
                      +++++|.++||||++||+|+|.++||+|++|+.+.      ..|+++|||+.||+||+.+|||+.++|++.||||++|++
T Consensus        19 ~~~~~~~~~L~dGv~LC~L~N~l~pg~i~ki~~~~------~~f~~~eNI~~FL~~~~~~Gv~~~~lF~~~DL~e~kn~~   92 (108)
T d1h67a_          19 RIGDNFMDGLKDGVILCELINKLQPGSVQKVNDPV------QNWHKLENIGNFLRAIKHYGVKPHDIFEANDLFENTNHT   92 (108)
T ss_dssp             CCCSCHHHHHHHCSHHHHHHHHHSTTSSTTCCCTT------SSHHHHHHHHHHHHHHHHHTSCGGGSCCHHHHHHTCCSH
T ss_pred             CCchHHHHHHcCchhHHHHHHHHHhcCCCccCCCc------chhHHHHHHHHHHHHHHHhCCCcccCCChHHHHhCCCHH
Confidence            57899999999999999999999999999998653      269999999999999999999999999999999999965



>d1ujoa_ a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p2xa_ a.40.1.1 (A:) Ras GTPase-activating-like protein rng2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1aoaa1 a.40.1.1 (A:121-251) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjoa_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sh5a1 a.40.1.1 (A:8-127) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aoaa2 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxxa1 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2qjza1 a.40.1.1 (A:13-132) Microtubule-associated protein eb1, N-terminal microtubule binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxxa2 a.40.1.1 (A:120-246) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sh5a2 a.40.1.1 (A:128-237) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bkra_ a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhda_ a.40.1.1 (A:) Utrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wixa_ a.40.3.1 (A:) Hook homolog 1, Hook1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hx8a1 a.7.8.2 (A:167-299) AP180 (Lap) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1hf8a1 a.7.8.2 (A:150-281) Clathrin assembly lymphoid myeloid leukaemia protein, Calm {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure