Diaphorina citri psyllid: psy5533

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------

MLGGADDKLSEVAFEYGRNLGIAFQLVDDLLDFISSSDAMGKPTAADLKLGLATAPVLFACEKFPELNPMIMRRFQEPGDVEKAFEFVHKSQGLEQTKFLARKHCVEAVRLASGLAESPYQKGLVVLTDLVLNRMK

ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHcccccHHHHHHHHccccccHHHHHHccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccc

M*GG*DDKLSEVAFEYGRNLGIAFQLVDDLLDFISSSDAMGKPTAADLKLGLATAPVLFACEKFPELNPMIMRRFQEPGDVEKAFEFVHKSQGLEQTKFLARKHCVEAVRLASGLAESPYQKGLVVLTDLVLNRM*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MLGGADDKLSEVAFEYGRNLGIAFQLVDDLLDFISSSDAMGKPTAADLKLGLATAPVLFACEKFPELNPMIMRRFQEPGDVEKAFEFVHKSQGLEQTKFLARKHCVEAVRLASGLAESPYQKGLVVLTDLVLNRMK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Decaprenyl-diphosphate synthase subunit 1	Supplies decaprenyl diphosphate, the precursor for the side chain of the isoprenoid quinones ubiquinone-10.	confident	Q5T2R2
Decaprenyl-diphosphate synthase subunit 1	Supplies decaprenyl diphosphate, the precursor for the side chain of the isoprenoid quinones ubiquinone-10.	confident	Q33DR2

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005783 [CC]	endoplasmic reticulum	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0000010 [MF]	trans-hexaprenyltranstransferase activity	probable	GO:0016765, GO:0016740, GO:0003674, GO:0003824
GO:0033554 [BP]	cellular response to stress	probable	GO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0008150, GO:0044699
GO:0050347 [MF]	trans-octaprenyltranstransferase activity	probable	GO:0016765, GO:0016740, GO:0003674, GO:0003824
GO:0046982 [MF]	protein heterodimerization activity	probable	GO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0014019 [BP]	neuroblast development	probable	GO:0032502, GO:0014016, GO:0048863, GO:0048864, GO:0044707, GO:0007399, GO:0009987, GO:0048869, GO:0030154, GO:0048468, GO:0048699, GO:0044767, GO:0032501, GO:0044763, GO:0008150, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0048856
GO:0008299 [BP]	isoprenoid biosynthetic process	probable	GO:0071704, GO:1901576, GO:0044710, GO:0006629, GO:0044238, GO:0006720, GO:0009987, GO:0044237, GO:0044249, GO:0009058, GO:0008150, GO:0008152, GO:0044255, GO:0008610
GO:0009536 [CC]	plastid	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0043066 [BP]	negative regulation of apoptotic process	probable	GO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0004161 [MF]	dimethylallyltranstransferase activity	probable	GO:0016765, GO:0016740, GO:0003674, GO:0004659, GO:0003824

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MZV, chain A
Confidence level:very confident
Coverage over the Query: 1-33,44-136
View the alignment between query and template
View the model in PyMOL