Psyllid ID: psy5533

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------
MLGGADDKLSEVAFEYGRNLGIAFQLVDDLLDFISSSDAMGKPTAADLKLGLATAPVLFACEKFPELNPMIMRRFQEPGDVEKAFEFVHKSQGLEQTKFLARKHCVEAVRLASGLAESPYQKGLVVLTDLVLNRMK
ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHccccHHHHHHHHHccccccHHHHHHccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccc
ccccccHHHHHHHHHHHccHHHHHHHHHHHHcccccHHHcccccHHHHHcccccHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccc
MLGGADDKLSEVAFEYGRNLGIAFQLVDDLLDfisssdamgkptaADLKLGLatapvlfacekfpelnpMIMRrfqepgdveKAFEFVhksqgleqtKFLARKHCVEAVRLAsglaespyqkglVVLTDLVLNRMK
MLGGADDKLSEVAFEYGRNLGIAFQLVDDLLDFISSSDAMGKPTAADLKLGLATAPVLFACEKFPELNPMIMRRFQEPGDVEKAFEFVHKSQGLEQTKFLARKHCVEAVRLasglaespyqkglvvltdlVLNRMK
MLGGADDKLSEVAFEYGRNLGIAFQLVDDLLDFISSSDAMGKPTAADLKLGLATAPVLFACEKFPELNPMIMRRFQEPGDVEKAFEFVHKSQGLEQTKFLARKHCVEAVRLASGLAESPYQKGLVVLTDLVLNRMK
**********EVAFEYGRNLGIAFQLVDDLLDFISSSDAMGKPTAADLKLGLATAPVLFACEKFPELNPMIMRRFQEPGDVEKAFEFVHKSQGLEQTKFLARKHCVEAVRLASGLAESPYQKGLVVLTDLVL****
M*GG*DDKLSEVAFEYGRNLGIAFQLVDDLLDFISSSDAMGKPTAADLKLGLATAPVLFACEKFPELNPMIMRRFQEPGDVEKAFEFVHKSQGLEQTKFLARKHCVEAVRLASGLAESPYQKGLVVLTDLVLNRM*
MLGGADDKLSEVAFEYGRNLGIAFQLVDDLLDFISSSDAMGKPTAADLKLGLATAPVLFACEKFPELNPMIMRRFQEPGDVEKAFEFVHKSQGLEQTKFLARKHCVEAVRLASGLAESPYQKGLVVLTDLVLNRMK
*LGGADDKLSEVAFEYGRNLGIAFQLVDDLLDFISSSDAMGKPTAADLKLGLATAPVLFACEKFPELNPMIMRRFQEPGDVEKAFEFVHKSQGLEQTKFLARKHCVEAVRLASGLAESPYQKGLVVLTDLVLNRM*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLGGADDKLSEVAFEYGRNLGIAFQLVDDLLDFISSSDAMGKPTAADLKLGLATAPVLFACEKFPELNPMIMRRFQEPGDVEKAFEFVHKSQGLEQTKFLARKHCVEAVRLASGLAESPYQKGLVVLTDLVLNRMK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query136 2.2.26 [Sep-21-2011]
Q5T2R2415 Decaprenyl-diphosphate sy yes N/A 1.0 0.327 0.573 3e-43
Q33DR2409 Decaprenyl-diphosphate sy yes N/A 1.0 0.332 0.551 3e-40
Q7S565449 Probable hexaprenyl pyrop N/A N/A 1.0 0.302 0.470 4e-31
Q6CBH3452 Probable hexaprenyl pyrop yes N/A 1.0 0.300 0.485 2e-30
Q54VJ9456 Decaprenyl-diphosphate sy yes N/A 1.0 0.298 0.455 3e-30
Q653T6430 Solanesyl-diphosphate syn yes N/A 1.0 0.316 0.408 2e-28
O43091378 Decaprenyl-diphosphate sy yes N/A 1.0 0.359 0.455 4e-28
P18900473 Hexaprenyl pyrophosphate yes N/A 1.0 0.287 0.474 1e-27
P31171323 Prenyl transferase OS=Cya N/A N/A 0.897 0.377 0.450 3e-26
Q5HZ00422 Solanesyl diphosphate syn no N/A 1.0 0.322 0.380 5e-23
>sp|Q5T2R2|DPS1_HUMAN Decaprenyl-diphosphate synthase subunit 1 OS=Homo sapiens GN=PDSS1 PE=1 SV=1 Back     alignment and function desciption
 Score =  173 bits (439), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 78/136 (57%), Positives = 108/136 (79%)

Query: 1   MLGGADDKLSEVAFEYGRNLGIAFQLVDDLLDFISSSDAMGKPTAADLKLGLATAPVLFA 60
           +LG  D  + E+A++YG+N+GIAFQL+DD+LDF S SD MGKPT+ADLKLGLAT PVLFA
Sbjct: 280 VLGCPDPVVHEIAYQYGKNVGIAFQLIDDVLDFTSCSDQMGKPTSADLKLGLATGPVLFA 339

Query: 61  CEKFPELNPMIMRRFQEPGDVEKAFEFVHKSQGLEQTKFLARKHCVEAVRLASGLAESPY 120
           C++FPE+N MIMRRF  PGDV++A ++V +S G++QT +LA+++C EA+R  S L  SP 
Sbjct: 340 CQQFPEMNAMIMRRFSLPGDVDRARQYVLQSDGVQQTTYLAQQYCHEAIREISKLRPSPE 399

Query: 121 QKGLVVLTDLVLNRMK 136
           +  L+ L+++VL R K
Sbjct: 400 RDALIQLSEIVLTRDK 415
Supplies decaprenyl diphosphate, the precursor for the side chain of the isoprenoid quinones ubiquinone-10.
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 9EC: 1
>sp|Q33DR2|DPS1_MOUSE Decaprenyl-diphosphate synthase subunit 1 OS=Mus musculus GN=Pdss1 PE=1 SV=1 Back     alignment and function description
>sp|Q7S565|COQ1_NEUCR Probable hexaprenyl pyrophosphate synthase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU02305 PE=3 SV=1 Back     alignment and function description
>sp|Q6CBH3|COQ1_YARLI Probable hexaprenyl pyrophosphate synthase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COQ1 PE=3 SV=1 Back     alignment and function description
>sp|Q54VJ9|DPS1_DICDI Decaprenyl-diphosphate synthase OS=Dictyostelium discoideum GN=coq1 PE=3 SV=1 Back     alignment and function description
>sp|Q653T6|SPS1_ORYSJ Solanesyl-diphosphate synthase 1, mitochondrial OS=Oryza sativa subsp. japonica GN=SPS1 PE=1 SV=1 Back     alignment and function description
>sp|O43091|DPS1_SCHPO Decaprenyl-diphosphate synthase subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dps1 PE=1 SV=1 Back     alignment and function description
>sp|P18900|COQ1_YEAST Hexaprenyl pyrophosphate synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COQ1 PE=1 SV=1 Back     alignment and function description
>sp|P31171|PREA_CYAPA Prenyl transferase OS=Cyanophora paradoxa GN=preA PE=3 SV=1 Back     alignment and function description
>sp|Q5HZ00|SPS3_ARATH Solanesyl diphosphate synthase 3, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SPS3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query136
345494369 475 PREDICTED: decaprenyl-diphosphate syntha 1.0 0.286 0.852 5e-66
242011677 262 Decaprenyl-diphosphate synthase subunit, 1.0 0.519 0.830 3e-64
270001562 339 hypothetical protein TcasGA2_TC000408 [T 1.0 0.401 0.801 2e-61
350405488 407 PREDICTED: decaprenyl-diphosphate syntha 1.0 0.334 0.808 2e-61
340726208 407 PREDICTED: decaprenyl-diphosphate syntha 1.0 0.334 0.808 2e-61
91077592 446 PREDICTED: similar to AGAP000591-PA [Tri 1.0 0.304 0.801 2e-61
347964117 480 AGAP000591-PA [Anopheles gambiae str. PE 1.0 0.283 0.779 3e-61
157127995 249 trans-prenyltransferase [Aedes aegypti] 1.0 0.546 0.779 4e-61
312383692197 hypothetical protein AND_03051 [Anophele 1.0 0.690 0.779 7e-61
383857313 340 PREDICTED: decaprenyl-diphosphate syntha 1.0 0.4 0.801 9e-61
>gi|345494369|ref|XP_001602352.2| PREDICTED: decaprenyl-diphosphate synthase subunit 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  255 bits (651), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 132/136 (97%)

Query: 1   MLGGADDKLSEVAFEYGRNLGIAFQLVDDLLDFISSSDAMGKPTAADLKLGLATAPVLFA 60
           MLGGAD++L+E+AF+YGRN+G+AFQLVDDLLDF+SSSDAMGKPTAADLKLGLATAPVLFA
Sbjct: 340 MLGGADERLAELAFQYGRNIGLAFQLVDDLLDFVSSSDAMGKPTAADLKLGLATAPVLFA 399

Query: 61  CEKFPELNPMIMRRFQEPGDVEKAFEFVHKSQGLEQTKFLARKHCVEAVRLASGLAESPY 120
           CE+FPELNPMIMRRFQEPGDVEKAFE VHKSQGLEQT+FLA+KHCVEAVRLA  LAESPY
Sbjct: 400 CERFPELNPMIMRRFQEPGDVEKAFELVHKSQGLEQTRFLAKKHCVEAVRLAQTLAESPY 459

Query: 121 QKGLVVLTDLVLNRMK 136
           QK L+V++DLV+NR+K
Sbjct: 460 QKSLMVVSDLVINRIK 475

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242011677|ref|XP_002426574.1| Decaprenyl-diphosphate synthase subunit, putative [Pediculus humanus corporis] gi|212510711|gb|EEB13836.1| Decaprenyl-diphosphate synthase subunit, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|270001562|gb|EEZ98009.1| hypothetical protein TcasGA2_TC000408 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350405488|ref|XP_003487449.1| PREDICTED: decaprenyl-diphosphate synthase subunit 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340726208|ref|XP_003401453.1| PREDICTED: decaprenyl-diphosphate synthase subunit 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|91077592|ref|XP_973319.1| PREDICTED: similar to AGAP000591-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|347964117|ref|XP_565746.4| AGAP000591-PA [Anopheles gambiae str. PEST] gi|333466880|gb|EAL41155.4| AGAP000591-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157127995|ref|XP_001661265.1| trans-prenyltransferase [Aedes aegypti] gi|108882325|gb|EAT46550.1| AAEL002287-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|312383692|gb|EFR28678.1| hypothetical protein AND_03051 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|383857313|ref|XP_003704149.1| PREDICTED: decaprenyl-diphosphate synthase subunit 1-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query136
FB|FBgn0051005436 qless "qless" [Drosophila mela 1.0 0.311 0.764 7.8e-55
UNIPROTKB|E1BZW8366 PDSS1 "Uncharacterized protein 1.0 0.371 0.580 3.7e-39
UNIPROTKB|F1RTW8410 PDSS1 "Uncharacterized protein 1.0 0.331 0.573 3.7e-39
UNIPROTKB|Q5T2R2415 PDSS1 "Decaprenyl-diphosphate 1.0 0.327 0.573 9.9e-39
ZFIN|ZDB-GENE-030131-4430411 pdss1 "prenyl (decaprenyl) dip 1.0 0.330 0.573 2.6e-38
UNIPROTKB|F6RJN8418 PDSS1 "Uncharacterized protein 1.0 0.325 0.558 5.5e-38
UNIPROTKB|F1PV51365 PDSS1 "Uncharacterized protein 1.0 0.372 0.566 5.5e-38
MGI|MGI:1889278409 Pdss1 "prenyl (solanesyl) diph 1.0 0.332 0.551 2.1e-36
WB|WBGene00000761393 coq-1 [Caenorhabditis elegans 0.823 0.284 0.633 7.4e-34
UNIPROTKB|I3LJ49145 I3LJ49 "Uncharacterized protei 0.941 0.882 0.514 3.7e-32
FB|FBgn0051005 qless "qless" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 566 (204.3 bits), Expect = 7.8e-55, P = 7.8e-55
 Identities = 104/136 (76%), Positives = 123/136 (90%)

Query:     1 MLGGADDKLSEVAFEYGRNLGIAFQLVDDLLDFISSSDAMGKPTAADLKLGLATAPVLFA 60
             ++  ADD ++EVAF+YGRN+G+AFQLVDD+LDF+SS++ MGKPTAADLKLGLATAPVLFA
Sbjct:   301 VIAQADDNVAEVAFQYGRNIGLAFQLVDDMLDFVSSTEQMGKPTAADLKLGLATAPVLFA 360

Query:    61 CEKFPELNPMIMRRFQEPGDVEKAFEFVHKSQGLEQTKFLARKHCVEAVRLASGLAESPY 120
             CEK+PELNPM+MRRF EPGDVE+AFE VHKS GLEQT+FLA+KHC EA+RLA  L ESPY
Sbjct:   361 CEKYPELNPMVMRRFSEPGDVERAFELVHKSHGLEQTRFLAKKHCNEAIRLAQELTESPY 420

Query:   121 QKGLVVLTDLVLNRMK 136
             QKGL V+ DLV+NRMK
Sbjct:   421 QKGLQVVADLVINRMK 436
GO:0000010 "trans-hexaprenyltranstransferase activity" evidence=ISS
GO:0008299 "isoprenoid biosynthetic process" evidence=IEA
GO:0033554 "cellular response to stress" evidence=IMP
GO:0043066 "negative regulation of apoptotic process" evidence=IMP
GO:0014019 "neuroblast development" evidence=IMP
UNIPROTKB|E1BZW8 PDSS1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1RTW8 PDSS1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5T2R2 PDSS1 "Decaprenyl-diphosphate synthase subunit 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-4430 pdss1 "prenyl (decaprenyl) diphosphate synthase, subunit 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F6RJN8 PDSS1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PV51 PDSS1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1889278 Pdss1 "prenyl (solanesyl) diphosphate synthase, subunit 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
WB|WBGene00000761 coq-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|I3LJ49 I3LJ49 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q33DR2DPS1_MOUSE2, ., 5, ., 1, ., 9, 10.55141.00.3325yesN/A
Q5T2R2DPS1_HUMAN2, ., 5, ., 1, ., 9, 10.57351.00.3277yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.5.10.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
TIGR02749322 TIGR02749, prenyl_cyano, solanesyl diphosphate syn 2e-39
CHL00151323 CHL00151, preA, prenyl transferase; Reviewed 8e-37
PLN02890422 PLN02890, PLN02890, geranyl diphosphate synthase 2e-34
PLN02857416 PLN02857, PLN02857, octaprenyl-diphosphate synthas 3e-33
COG0142322 COG0142, IspA, Geranylgeranyl pyrophosphate syntha 9e-29
cd00685259 cd00685, Trans_IPPS_HT, Trans-Isoprenyl Diphosphat 5e-24
pfam00348260 pfam00348, polyprenyl_synt, Polyprenyl synthetase 3e-16
cd00867236 cd00867, Trans_IPPS, Trans-Isoprenyl Diphosphate S 2e-14
PRK10888323 PRK10888, PRK10888, octaprenyl diphosphate synthas 3e-14
TIGR02748319 TIGR02748, GerC3_HepT, heptaprenyl diphosphate syn 3e-14
cd00385243 cd00385, Isoprenoid_Biosyn_C1, Isoprenoid Biosynth 8e-09
PRK10581299 PRK10581, PRK10581, geranyltranstransferase; Provi 3e-06
>gnl|CDD|131796 TIGR02749, prenyl_cyano, solanesyl diphosphate synthase Back     alignment and domain information 
 Score =  134 bits (338), Expect = 2e-39
 Identities = 55/135 (40%), Positives = 88/135 (65%)

Query: 1   MLGGADDKLSEVAFEYGRNLGIAFQLVDDLLDFISSSDAMGKPTAADLKLGLATAPVLFA 60
           +L     +++   +EYG++LG+AFQ+VDD+LDF  S++ +GKP  +DL  G  TAPVLFA
Sbjct: 187 VLSDVPSQVANDLYEYGKHLGLAFQVVDDILDFTGSTEQLGKPAGSDLMKGNLTAPVLFA 246

Query: 61  CEKFPELNPMIMRRFQEPGDVEKAFEFVHKSQGLEQTKFLARKHCVEAVRLASGLAESPY 120
            E+ P+L+ +I R F + GD+E+A   V KS G+++ + LA++    A++  S L  SP 
Sbjct: 247 LEEEPKLSELIEREFSQKGDLEQALSLVRKSGGIKKARELAKEQAQLALQSLSFLPPSPP 306

Query: 121 QKGLVVLTDLVLNRM 135
           ++ L  L   VL+R+
Sbjct: 307 REALKELVHFVLSRL 321

Members of this family all are from cyanobacteria or plastid-containing eukaryotes. A member from Arabidopsis (where both plastoquinone and ubiquinone contain the C(45) prenyl moiety) was characterized by heterologous expression as a solanesyl diphosphate synthase [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone]. Length = 322
>gnl|CDD|164542 CHL00151, preA, prenyl transferase; Reviewed Back     alignment and domain information
>gnl|CDD|178478 PLN02890, PLN02890, geranyl diphosphate synthase Back     alignment and domain information
>gnl|CDD|215462 PLN02857, PLN02857, octaprenyl-diphosphate synthase Back     alignment and domain information
>gnl|CDD|223220 COG0142, IspA, Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|173833 cd00685, Trans_IPPS_HT, Trans-Isoprenyl Diphosphate Synthases, head-to-tail Back     alignment and domain information
>gnl|CDD|215873 pfam00348, polyprenyl_synt, Polyprenyl synthetase Back     alignment and domain information
>gnl|CDD|173836 cd00867, Trans_IPPS, Trans-Isoprenyl Diphosphate Synthases Back     alignment and domain information
>gnl|CDD|182813 PRK10888, PRK10888, octaprenyl diphosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|131795 TIGR02748, GerC3_HepT, heptaprenyl diphosphate synthase component II Back     alignment and domain information
>gnl|CDD|173830 cd00385, Isoprenoid_Biosyn_C1, Isoprenoid Biosynthesis enzymes, Class 1 Back     alignment and domain information
>gnl|CDD|182567 PRK10581, PRK10581, geranyltranstransferase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 136
PLN02890422 geranyl diphosphate synthase 100.0
TIGR02749322 prenyl_cyano solanesyl diphosphate synthase. Membe 100.0
PLN02857416 octaprenyl-diphosphate synthase 100.0
CHL00151323 preA prenyl transferase; Reviewed 100.0
TIGR02748319 GerC3_HepT heptaprenyl diphosphate synthase compon 99.97
PRK10888323 octaprenyl diphosphate synthase; Provisional 99.97
COG0142322 IspA Geranylgeranyl pyrophosphate synthase [Coenzy 99.97
KOG0776|consensus384 99.94
PRK10581299 geranyltranstransferase; Provisional 99.93
cd00685259 Trans_IPPS_HT Trans-Isoprenyl Diphosphate Synthase 99.88
PF00348260 polyprenyl_synt: Polyprenyl synthetase; InterPro: 99.86
cd00867236 Trans_IPPS Trans-Isoprenyl Diphosphate Synthases. 99.73
KOG0777|consensus322 99.64
KOG0711|consensus347 99.62
cd00385243 Isoprenoid_Biosyn_C1 Isoprenoid Biosynthesis enzym 98.85
PF00494267 SQS_PSY: Squalene/phytoene synthase; InterPro: IPR 92.69
cd00683265 Trans_IPPS_HH Trans-Isoprenyl Diphosphate Synthase 91.23
PF0678385 UPF0239: Uncharacterised protein family (UPF0239); 90.93
PLN02632334 phytoene synthase 90.44
TIGR03464266 HpnC squalene synthase HpnC. This family of genes 89.48
TIGR01559336 squal_synth farnesyl-diphosphate farnesyltransfera 89.35
TIGR03465266 HpnD squalene synthase HpnD. The genes of this fam 88.09
cd00685259 Trans_IPPS_HT Trans-Isoprenyl Diphosphate Synthase 83.87
TIGR02748 319 GerC3_HepT heptaprenyl diphosphate synthase compon 83.59
PRK10888 323 octaprenyl diphosphate synthase; Provisional 83.12
PF00348260 polyprenyl_synt: Polyprenyl synthetase; InterPro: 81.72
>PLN02890 geranyl diphosphate synthase Back     alignment and domain information 
Probab=100.00  E-value=1.9e-32  Score=212.32  Aligned_cols=136  Identities=43%  Similarity=0.760  Sum_probs=126.6

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHhhhhhhcCCccccCCCCchhHhhCcccHHHHHHhhcCCcchHHHHhhcCChhh
Q psy5533           1 MLGGADDKLSEVAFEYGRNLGIAFQLVDDLLDFISSSDAMGKPTAADLKLGLATAPVLFACEKFPELNPMIMRRFQEPGD   80 (136)
Q Consensus         1 i~ag~~~~~~~~l~~~G~~lG~afQi~DDlld~~~~~~~~GK~~~~Di~~gk~Tlp~l~a~~~~~~~~~~l~~~~~~~~~   80 (136)
                      +++|++++.+..+++||.++|+||||+||++||+++++.+|||.++|+++||+|+|++++++..+.+..++.+...++++
T Consensus       281 ilaga~~~~~~~l~~fG~~lGlAFQI~DDiLD~~g~~~~~GK~~g~DL~eGk~TlPvl~al~~~~~l~~~l~~~~~~~~~  360 (422)
T PLN02890        281 ILAGQTAEVAVLAFEYGRNLGLAFQLIDDVLDFTGTSASLGKGSLSDIRHGVITAPILFAMEEFPQLREVVDRGFDNPAN  360 (422)
T ss_pred             HHcCcCHHHHHHHHHHHHHHHHHHHHHHHHHhhcCChhhhCCCchhhHhcCCccHHHHHHHhcCHHHHHHHhcccCCHHH
Confidence            46899999999999999999999999999999999999999999999999999999999998766666677666678889


Q ss_pred             HHHHHHHHHhcCHHHHHHHHHHHHHHHHHHHhhcCCCCH------HHHHHHHHHHHHHccCC
Q psy5533          81 VEKAFEFVHKSQGLEQTKFLARKHCVEAVRLASGLAESP------YQKGLVVLTDLVLNRMK  136 (136)
Q Consensus        81 ~~~i~~~i~~~g~~~~~~~~~~~~~~~A~~~l~~l~~~~------~~~~L~~l~~~~~~r~~  136 (136)
                      ++++.++|.++|++++|+..+++|.++|.+.|+.+|+++      .+..|..|++++.+|.+
T Consensus       361 v~~~~~~i~~~gaie~a~~la~~~~~~A~~~L~~lp~s~~~~~~~~r~~L~~L~~~vi~R~k  422 (422)
T PLN02890        361 VDIALEYLGKSRGIQRTRELAREHANLAAAAIESLPETDDEDVLTSRRALIDLTERVITRNK  422 (422)
T ss_pred             HHHHHHHHHHcCHHHHHHHHHHHHHHHHHHHHHhCCCCccccchHHHHHHHHHHHHHHhccC
Confidence            999999999999999999999999999999999999876      68999999999999975

>TIGR02749 prenyl_cyano solanesyl diphosphate synthase Back     alignment and domain information
>PLN02857 octaprenyl-diphosphate synthase Back     alignment and domain information
>CHL00151 preA prenyl transferase; Reviewed Back     alignment and domain information
>TIGR02748 GerC3_HepT heptaprenyl diphosphate synthase component II Back     alignment and domain information
>PRK10888 octaprenyl diphosphate synthase; Provisional Back     alignment and domain information
>COG0142 IspA Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>KOG0776|consensus Back     alignment and domain information
>PRK10581 geranyltranstransferase; Provisional Back     alignment and domain information
>cd00685 Trans_IPPS_HT Trans-Isoprenyl Diphosphate Synthases, head-to-tail Back     alignment and domain information
>PF00348 polyprenyl_synt: Polyprenyl synthetase; InterPro: IPR000092 A variety of isoprenoid compounds are synthesized by various organisms Back     alignment and domain information
>cd00867 Trans_IPPS Trans-Isoprenyl Diphosphate Synthases Back     alignment and domain information
>KOG0777|consensus Back     alignment and domain information
>KOG0711|consensus Back     alignment and domain information
>cd00385 Isoprenoid_Biosyn_C1 Isoprenoid Biosynthesis enzymes, Class 1 Back     alignment and domain information
>PF00494 SQS_PSY: Squalene/phytoene synthase; InterPro: IPR002060 Squalene synthase 2 Back     alignment and domain information
>cd00683 Trans_IPPS_HH Trans-Isoprenyl Diphosphate Synthases, head-to-head Back     alignment and domain information
>PF06783 UPF0239: Uncharacterised protein family (UPF0239); InterPro: IPR009621 This is a group of transmembrane proteins of unknown function Back     alignment and domain information
>PLN02632 phytoene synthase Back     alignment and domain information
>TIGR03464 HpnC squalene synthase HpnC Back     alignment and domain information
>TIGR01559 squal_synth farnesyl-diphosphate farnesyltransferase Back     alignment and domain information
>TIGR03465 HpnD squalene synthase HpnD Back     alignment and domain information
>cd00685 Trans_IPPS_HT Trans-Isoprenyl Diphosphate Synthases, head-to-tail Back     alignment and domain information
>TIGR02748 GerC3_HepT heptaprenyl diphosphate synthase component II Back     alignment and domain information
>PRK10888 octaprenyl diphosphate synthase; Provisional Back     alignment and domain information
>PF00348 polyprenyl_synt: Polyprenyl synthetase; InterPro: IPR000092 A variety of isoprenoid compounds are synthesized by various organisms Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
3apz_A348 Apo Form Of Arabidopsis MediumLONG-Chain Length Pre 4e-24
3aq0_A348 Ligand-Bound Form Of Arabidopsis MediumLONG-Chain L 5e-24
3mzv_A341 Crystal Structure Of A Decaprenyl Diphosphate Synth 4e-13
3oyr_A345 Crystal Structure Of Polyprenyl Synthase From Caulo 1e-09
3aqb_B325 M. Luteus B-P 26 Heterodimeric Hexaprenyl Diphospha 3e-08
3nf2_A352 Crystal Structure Of Polyprenyl Synthetase From Str 7e-08
3tc1_A315 Crystal Structure Of Octaprenyl Pyrophosphate Synth 1e-07
1wy0_A342 Crystal Structure Of Geranylgeranyl Pyrophosphate S 5e-07
1wl1_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 1e-06
1vg2_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 1e-06
1vg6_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 2e-06
1v4j_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 2e-06
1vg4_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 2e-06
1v4e_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 2e-06
1vg3_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 2e-06
2azl_A299 Crystal Structure For The Mutant F117e Of Thermotog 2e-06
1wl2_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 2e-06
1wl0_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 2e-06
1wl3_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 2e-06
1vg7_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 2e-06
1v4h_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 2e-06
1v4k_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 2e-06
1v4i_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 2e-06
1wkz_A299 Crystal Structure Of Octaprenyl Pyrophosphate Synth 2e-06
3p8r_A302 Crystal Structure Of Polyprenyl Synthase From Vibri 3e-06
4dhd_A358 Crystal Structure Of Isoprenoid Synthase A3msh1 (Ta 4e-06
3lmd_A360 Crystal Structure Of Geranylgeranyl Pyrophosphate S 4e-06
3rmg_A334 Crystal Structure Of Geranylgeranyl Pyrophosphate S 7e-06
2for_A323 Crystal Structure Of The Shigella Flexneri Farnesyl 1e-05
3kra_A295 Mint Heterotetrameric Geranyl Pyrophosphate Synthas 1e-05
1rqi_A300 Active Conformation Of Farnesyl Pyrophosphate Synth 1e-05
1rqj_A299 Active Conformation Of Farnesyl Pyrophosphate Synth 2e-05
3lk5_A380 Crystal Structure Of Putative Geranylgeranyl Pyroph 6e-05
3pko_A334 Crystal Structure Of Geranylgeranyl Pyrophosphate S 1e-04
3n3d_A335 Crystal Structure Of Geranylgeranyl Pyrophosphate S 1e-04
2h8o_A335 The 1.6a Crystal Structure Of The Geranyltransferas 4e-04
>pdb|3APZ|A Chain A, Apo Form Of Arabidopsis MediumLONG-Chain Length Prenyl Pyrophosphate Synthase Length = 348 Back     alignment and structure 
Iteration: 1

 Score =  106 bits (265), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 93/142 (65%), Gaps = 6/142 (4%)
Query: 1   MLGGADDKLSEVAFEYGRNLGIAFQLVDDLLDFISSSDAMGKPTAADLKLGLATAPVLFA 60
           +L G   +++ +AFEYGRNLG+AFQL+DD+LDF  +S ++GK + +D++ G+ TAP+LFA
Sbjct: 207 VLTGQTAEVAVLAFEYGRNLGLAFQLIDDILDFTGTSASLGKGSLSDIRHGVITAPILFA 266
Query: 61  CEKFPELNPMIMRRFQEPGDVEKAFEFVHKSQGLEQTKFLARKHCVEAVRLASGLAESPY 120
            E+FP+L  ++ +  ++P +V+ A E++ KS+G+++ + LA +H   A      L E+  
Sbjct: 267 MEEFPQLREVVDQVEKDPRNVDIALEYLGKSKGIQRARELAMEHANLAAAAIGSLPETDN 326
Query: 121 Q------KGLVVLTDLVLNRMK 136
           +      + L+ LT  V+ R K
Sbjct: 327 EDVKRSRRALIDLTHRVITRNK 348
>pdb|3AQ0|A Chain A, Ligand-Bound Form Of Arabidopsis MediumLONG-Chain Length Prenyl Pyrophosphate Synthase (Surface Polar Residue Mutant) Length = 348 Back     alignment and structure
>pdb|3MZV|A Chain A, Crystal Structure Of A Decaprenyl Diphosphate Synthase From Rhodobacter Capsulatus Length = 341 Back     alignment and structure
>pdb|3OYR|A Chain A, Crystal Structure Of Polyprenyl Synthase From Caulobacter Crescentus Cb15 Complexed With Calcium And Isoprenyl Diphosphate Length = 345 Back     alignment and structure
>pdb|3AQB|B Chain B, M. Luteus B-P 26 Heterodimeric Hexaprenyl Diphosphate Synthase In Complex With Magnesium Length = 325 Back     alignment and structure
>pdb|3NF2|A Chain A, Crystal Structure Of Polyprenyl Synthetase From Streptomyces Coelicolor A3(2) Length = 352 Back     alignment and structure
>pdb|3TC1|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Helicobacter Pylori Length = 315 Back     alignment and structure
>pdb|1WY0|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthetase From Pyrococcus Horikoshii Ot3 Length = 342 Back     alignment and structure
>pdb|1WL1|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima H74a Mutant Length = 299 Back     alignment and structure
>pdb|1VG2|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima A76y Mutant Length = 299 Back     alignment and structure
>pdb|1VG6|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima F132aL128AI123A MUTANT Length = 299 Back     alignment and structure
>pdb|1V4J|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima V73y Mutant Length = 299 Back     alignment and structure
>pdb|1VG4|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima F132aL128A MUTANT Length = 299 Back     alignment and structure
>pdb|1V4E|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima Length = 299 Back     alignment and structure
>pdb|1VG3|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima A76yS77F MUTANT Length = 299 Back     alignment and structure
>pdb|2AZL|A Chain A, Crystal Structure For The Mutant F117e Of Thermotoga Maritima Octaprenyl Pyrophosphate Synthase Length = 299 Back     alignment and structure
>pdb|1WL2|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima R90a Mutant Length = 299 Back     alignment and structure
>pdb|1WL0|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima R44a Mutant Length = 299 Back     alignment and structure
>pdb|1WL3|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima R91a Mutant Length = 299 Back     alignment and structure
>pdb|1VG7|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima F132aL128AI123AD62A MUTANT Length = 299 Back     alignment and structure
>pdb|1V4H|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima F52a Mutant Length = 299 Back     alignment and structure
>pdb|1V4K|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima S77f Mutant Length = 299 Back     alignment and structure
>pdb|1V4I|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima F132a Mutant Length = 299 Back     alignment and structure
>pdb|1WKZ|A Chain A, Crystal Structure Of Octaprenyl Pyrophosphate Synthase From Hyperthermophilic Thermotoga Maritima K41a Mutant Length = 299 Back     alignment and structure
>pdb|3P8R|A Chain A, Crystal Structure Of Polyprenyl Synthase From Vibrio Cholerae Length = 302 Back     alignment and structure
>pdb|4DHD|A Chain A, Crystal Structure Of Isoprenoid Synthase A3msh1 (Target Efi-501992) From Pyrobaculum Calidifontis Length = 358 Back     alignment and structure
>pdb|3LMD|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase From Corynebacterium Glutamicum Atcc 13032 Length = 360 Back     alignment and structure
>pdb|3RMG|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase From Bacteroides Thetaiotaomicron Length = 334 Back     alignment and structure
>pdb|2FOR|A Chain A, Crystal Structure Of The Shigella Flexneri Farnesyl Pyrophosphate Synthase Complex With An Isopentenyl Pyrophosphate Length = 323 Back     alignment and structure
>pdb|3KRA|A Chain A, Mint Heterotetrameric Geranyl Pyrophosphate Synthase In Complex With Magnesium Length = 295 Back     alignment and structure
>pdb|1RQI|A Chain A, Active Conformation Of Farnesyl Pyrophosphate Synthase Bound To Isopentyl Pyrophosphate And Dimethylallyl S- Thiolodiphosphate Length = 300 Back     alignment and structure
>pdb|1RQJ|A Chain A, Active Conformation Of Farnesyl Pyrophosphate Synthase Bound To Isopentyl Pyrophosphate And Risedronate Length = 299 Back     alignment and structure
>pdb|3LK5|A Chain A, Crystal Structure Of Putative Geranylgeranyl Pyrophosphate Synthase From Corynebacterium Glutamicum Length = 380 Back     alignment and structure
>pdb|3PKO|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase From Lactobacillus Brevis Atcc 367 Complexed With Citrate Length = 334 Back     alignment and structure
>pdb|3N3D|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase From Lactobacillus Brevis Atcc 367 Length = 335 Back     alignment and structure
>pdb|2H8O|A Chain A, The 1.6a Crystal Structure Of The Geranyltransferase From Agrobacterium Tumefaciens Length = 335 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
3apz_A348 Geranyl diphosphate synthase; prenyltransferase, a 2e-55
3pko_A334 Geranylgeranyl pyrophosphate synthase; isoprenyl d 1e-37
3oyr_A345 Trans-isoprenyl diphosphate synthase; isoprenyl sy 3e-35
3lmd_A360 Geranylgeranyl pyrophosphate synthase; isoprenyl d 1e-34
3rmg_A334 Octaprenyl-diphosphate synthase; structural genomi 4e-34
3mzv_A341 Decaprenyl diphosphate synthase; transferase, stru 1e-33
3aqb_B325 Component B of hexaprenyl diphosphate synthase; pr 4e-33
3tc1_A315 Octaprenyl pyrophosphate synthase; all alpha-helic 2e-28
1wy0_A342 Geranylgeranyl pyrophosphate synthetase; pyrococcu 2e-27
1v4e_A299 Octoprenyl-diphosphate synthase; trans-type prenyl 3e-26
4dhd_A358 Polyprenyl synthetase; isoprenoid synthesis, isopr 8e-26
2q80_A301 Geranylgeranyl pyrophosphate synthetase; isoprenoi 1e-24
3nf2_A352 Putative polyprenyl synthetase; isoprenyl diphosph 2e-24
3lk5_A380 Geranylgeranyl pyrophosphate synthase; structural 1e-21
1wmw_A330 Geranylgeranyl diphosphate synthetase; GGPP, preny 2e-21
3ipi_A295 Geranyltranstransferase; isoprene biosynthesis, he 7e-19
1uby_A367 FPS, farnesyl diphosphate synthase; transferase, i 5e-18
2azj_A289 Geranylgeranyl pyrophosphate synthetase; hexpps, t 2e-16
1rtr_A301 Geranyltranstransferase; 2.50A {Staphylococcus aur 6e-16
2qis_A374 Farnesyl pyrophosphate synthetase; trans-prenyltra 7e-15
3p8l_A302 Geranyltranstransferase; isoprenyl synthase, struc 1e-14
3uca_A324 Geranyltranstransferase; isoprenoid synthesis, iso 2e-14
4fp4_A285 Polyprenyl synthetase; isoprenoid synthesis, isopr 2e-14
2e8v_A340 Geranylgeranyl pyrophosphate synthetase; prenyltra 3e-14
1rqj_A299 Geranyltranstransferase; bisphosphonate, isoprenyl 4e-14
2h8o_A335 Geranyltranstransferase; geranyltransferase,agroba 8e-14
3pde_A309 Farnesyl-diphosphate synthase; isoprenyl diphospha 3e-13
3lom_A313 Geranyltranstransferase; geranyltransferase, struc 3e-13
4f62_A317 Geranyltranstransferase; enzyme function initiativ 4e-13
3ts7_A324 Geranyltranstransferase; isoprenoid synthesis, far 5e-13
2ihi_A395 Pyrophosphate synthase; PV092040, structural genom 1e-12
3lsn_A304 Geranyltranstransferase; structural genomics, prot 1e-12
3m0g_A297 Farnesyl diphosphate synthase; structural genomics 3e-12
3p8r_A302 Geranyltranstransferase; isoprenyl synthase, struc 4e-12
3npk_A291 Geranyltranstransferase; isoprene biosynthesis, SG 6e-12
1yhl_A362 Farnesyl pyrophosphate synthase; farnesyl diphosph 3e-11
3dyh_A390 Farnesyl pyrophosphate synthase; protein-bisphosph 1e-10
3llw_A311 Geranyltranstransferase (ISPA); structural genomic 3e-10
2j1p_A293 Geranylgeranyl pyrophosphate synthetase; transfera 6e-08
3qkc_B273 Geranyl diphosphate synthase small subunit; struct 2e-07
2her_A368 Fragment, farnesyl pyrophosphate synthase; farnesy 4e-07
3kra_B274 Geranyl diphosphate synthase small subunit; prenyl 1e-05
2ftz_A284 Geranyltranstransferase; TM0161, structural GE joi 9e-05
>3apz_A Geranyl diphosphate synthase; prenyltransferase, all alpha-helices fold, chroloplast, TRAN isoprenoid biosynthetic process; 2.60A {Arabidopsis thaliana} PDB: 3aq0_A* Length = 348 Back     alignment and structure
 Score =  175 bits (446), Expect = 2e-55
 Identities = 54/142 (38%), Positives = 93/142 (65%), Gaps = 6/142 (4%)

Query: 1   MLGGADDKLSEVAFEYGRNLGIAFQLVDDLLDFISSSDAMGKPTAADLKLGLATAPVLFA 60
           +L G   +++ +AFEYGRNLG+AFQL+DD+LDF  +S ++GK + +D++ G+ TAP+LFA
Sbjct: 207 VLTGQTAEVAVLAFEYGRNLGLAFQLIDDILDFTGTSASLGKGSLSDIRHGVITAPILFA 266

Query: 61  CEKFPELNPMIMRRFQEPGDVEKAFEFVHKSQGLEQTKFLARKHCVEAVRLASGLAESP- 119
            E+FP+L  ++ +  ++P +V+ A E++ KS+G+++ + LA +H   A      L E+  
Sbjct: 267 MEEFPQLREVVDQVEKDPRNVDIALEYLGKSKGIQRARELAMEHANLAAAAIGSLPETDN 326

Query: 120 -----YQKGLVVLTDLVLNRMK 136
                 ++ L+ LT  V+ R K
Sbjct: 327 EDVKRSRRALIDLTHRVITRNK 348
>3pko_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; HET: CIT; 1.98A {Lactobacillus brevis} PDB: 3n3d_A Length = 334 Back     alignment and structure
>3oyr_A Trans-isoprenyl diphosphate synthase; isoprenyl synthase, PSI, protein structure initiative; HET: IPE; 2.00A {Caulobacter crescentus} Length = 345 Back     alignment and structure
>3lmd_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, protein structure initiative, nysgrc; 1.90A {Corynebacterium glutamicum} PDB: 3q2q_A* Length = 360 Back     alignment and structure
>3rmg_A Octaprenyl-diphosphate synthase; structural genomics, protein structure initiative, isoprene biosynthesis, transferase; 2.30A {Bacteroides thetaiotaomicron} Length = 334 Back     alignment and structure
>3mzv_A Decaprenyl diphosphate synthase; transferase, structural genomics, PSI-2, protein structure initiative; 1.90A {Rhodobacter capsulatus} Length = 341 Back     alignment and structure
>3aqb_B Component B of hexaprenyl diphosphate synthase; prenyltransferase, transferase; 2.40A {Micrococcus luteus} PDB: 3aqc_B* Length = 325 Back     alignment and structure
>3tc1_A Octaprenyl pyrophosphate synthase; all alpha-helices fold, transferase; 2.00A {Helicobacter pylori} Length = 315 Back     alignment and structure
>1wy0_A Geranylgeranyl pyrophosphate synthetase; pyrococcus horikosh structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.20A {Pyrococcus horikoshii} Length = 342 Back     alignment and structure
>1v4e_A Octoprenyl-diphosphate synthase; trans-type prenyltransferase, thermophilic; 2.28A {Thermotoga maritima} SCOP: a.128.1.1 PDB: 1v4j_A 1wkz_A 1vg2_A 1wl3_A 1wl0_A 1wl2_A 1v4h_A 1v4i_A 1v4k_A 2azl_A 1wl1_A 1vg4_A 1vg3_A 1vg6_A 1vg7_A Length = 299 Back     alignment and structure
>4dhd_A Polyprenyl synthetase; isoprenoid synthesis, isoprenoid diphosphate synthase, trans; 1.65A {Pyrobaculum calidifontis} Length = 358 Back     alignment and structure
>2q80_A Geranylgeranyl pyrophosphate synthetase; isoprenoid pathway, isopentenyl transferase, structural GENO structural genomics consortium, SGC; HET: GRG; 2.70A {Homo sapiens} SCOP: a.128.1.1 Length = 301 Back     alignment and structure
>3nf2_A Putative polyprenyl synthetase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; 2.20A {Streptomyces coelicolor} Length = 352 Back     alignment and structure
>3lk5_A Geranylgeranyl pyrophosphate synthase; structural genomics, protein structure initiative, geranylge pyrophosphate synthase; 1.90A {Corynebacterium glutamicum} PDB: 3qqv_A* Length = 380 Back     alignment and structure
>1wmw_A Geranylgeranyl diphosphate synthetase; GGPP, prenyl diphosphate synthase, structural genom riken structural genomics/proteomics initiative; 1.55A {Thermus thermophilus} Length = 330 Back     alignment and structure
>3ipi_A Geranyltranstransferase; isoprene biosynthesis, helical bundle, protein structure initiative II (PSI II), structural genomics, nysgxrc; 1.90A {Methanosarcina mazei} Length = 295 Back     alignment and structure
>1uby_A FPS, farnesyl diphosphate synthase; transferase, isoprene biosynthesis, cholesterol biosynthesis; HET: DMA; 2.40A {Gallus gallus} SCOP: a.128.1.1 PDB: 1ubw_A* 1ubv_A* 1ubx_A* 1fps_A Length = 367 Back     alignment and structure
>2azj_A Geranylgeranyl pyrophosphate synthetase; hexpps, trans-prenyltransferase; 2.40A {Sulfolobus solfataricus} PDB: 2azk_A Length = 289 Back     alignment and structure
>1rtr_A Geranyltranstransferase; 2.50A {Staphylococcus aureus} SCOP: a.128.1.1 Length = 301 Back     alignment and structure
>2qis_A Farnesyl pyrophosphate synthetase; trans-prenyltransferase, structural genomics, structural GEN consortium, SGC, transferase; HET: RIS; 1.80A {Homo sapiens} PDB: 4dem_F* 1yv5_A* 1yq7_A* 2opm_A* 2opn_A* 3cp6_A* 2rah_A* 2vf6_A* 1zw5_A* 3b7l_A* 3s4j_A* 3rye_A* 3n45_F* 2f89_F* 2f7m_F* 2f8z_F* 2f8c_F* 2f92_F* 2f9k_F* 3n1v_F* ... Length = 374 Back     alignment and structure
>3p8l_A Geranyltranstransferase; isoprenyl synthase, structural genomics, PSI, protein struct initiative, nysgrc; 2.00A {Enterococcus faecalis} Length = 302 Back     alignment and structure
>3uca_A Geranyltranstransferase; isoprenoid synthesis, isoprenoid diphosphate synthase; 2.00A {Clostridium perfringens} Length = 324 Back     alignment and structure
>4fp4_A Polyprenyl synthetase; isoprenoid synthesis, isoprenoid diphosphate synthase, trans; HET: GER UNL; 2.00A {Pyrobaculum calidifontis} Length = 285 Back     alignment and structure
>2e8v_A Geranylgeranyl pyrophosphate synthetase; prenyltransferase, farnesyl pyrophosphate, bisphosphonate; HET: GRG; 1.80A {Saccharomyces cerevisiae} PDB: 2e8t_A* 2e8u_A* 2dh4_A* 2e8w_A* 2e8x_A* 2e90_A* 2e91_A* 2e92_A* 2e93_A* 2e94_A* 2e95_A* 2z4v_A* 2z4w_A* 2z4x_A* 2z4y_A* 2z4z_A* 2z50_A* 2z52_A* 2z78_A* 2z7h_A* ... Length = 340 Back     alignment and structure
>1rqj_A Geranyltranstransferase; bisphosphonate, isoprenyl synthase; HET: IPR RIS; 1.95A {Escherichia coli} SCOP: a.128.1.1 PDB: 1rqi_A* 2for_A* Length = 299 Back     alignment and structure
>2h8o_A Geranyltranstransferase; geranyltransferase,agrobacterium tumefaciens, structural GEN PSI-2, protein structure initiative; 1.60A {Agrobacterium tumefaciens} Length = 335 Back     alignment and structure
>3pde_A Farnesyl-diphosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative; HET: IPE; 1.75A {Lactobacillus brevis} PDB: 3m9u_A* Length = 309 Back     alignment and structure
>3lom_A Geranyltranstransferase; geranyltransferase, structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Legionella pneumophila subsp} Length = 313 Back     alignment and structure
>4f62_A Geranyltranstransferase; enzyme function initiative, structural genomics; 2.10A {Marinomonas SP} Length = 317 Back     alignment and structure
>3ts7_A Geranyltranstransferase; isoprenoid synthesis, farnesyl diphosphate synthase; 1.94A {Methylococcus capsulatus} Length = 324 Back     alignment and structure
>3lsn_A Geranyltranstransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; HET: MSE; 1.35A {Pseudomonas fluorescens} PDB: 3lji_A* 3p41_A* Length = 304 Back     alignment and structure
>3m0g_A Farnesyl diphosphate synthase; structural genomics, protein structure initiative, NYSGXRC, biosynthesis, transferase, PSI-2; 1.90A {Rhodobacter capsulatus} PDB: 3lvs_A Length = 297 Back     alignment and structure
>3p8r_A Geranyltranstransferase; isoprenyl synthase, structural genomics, PSI, protein struct initiative, nysgrc; 2.50A {Vibrio cholerae} Length = 302 Back     alignment and structure
>3npk_A Geranyltranstransferase; isoprene biosynthesis, SGX, structural genomics protein structure initiative; 1.50A {Campylobacter jejuni} Length = 291 Back     alignment and structure
>1yhl_A Farnesyl pyrophosphate synthase; farnesyl diphosphate synthase, bisphosphonate, dimethyl ALLY pyrophosphate sulfate, FPPS, transferase; HET: DMA RIS; 1.95A {Trypanosoma cruzi} PDB: 1yhk_A* 1yhm_A* 3iba_A* 3ick_A* 3icm_A* 3icn_A* 3icz_A* 3id0_A* Length = 362 Back     alignment and structure
>3dyh_A Farnesyl pyrophosphate synthase; protein-bisphosphonate complex, isoprene biosynthesis, transferase; HET: 721; 1.94A {Trypanosoma brucei} PDB: 2ewg_A* 2i19_A* 2p1c_A* 3dyf_A* 3dyg_A* 2ogd_A* 3efq_A* 3egt_A* Length = 390 Back     alignment and structure
>3llw_A Geranyltranstransferase (ISPA); structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Helicobacter pylori} PDB: 3q1o_A* Length = 311 Back     alignment and structure
>2j1p_A Geranylgeranyl pyrophosphate synthetase; transferase, isoprene biosynthesis, multifunctional enzyme, carotenoid biosynthesis; HET: GRG; 1.8A {Sinapis alba} PDB: 2j1o_A 3kra_A 3krc_A* 3krf_A* 3kro_A* 3krp_A* 3oab_A* 3oac_A* Length = 293 Back     alignment and structure
>3qkc_B Geranyl diphosphate synthase small subunit; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.20A {Antirrhinum majus} Length = 273 Back     alignment and structure
>3kra_B Geranyl diphosphate synthase small subunit; prenyltransferase, isoprene biosynthesis, isoprenyl pyrophosphate synthase, transferase; 1.90A {Mentha x piperita} PDB: 3krc_B* 3krf_B* 3kro_B* 3krp_B* 3oab_B* 3oac_B* Length = 274 Back     alignment and structure
>2ftz_A Geranyltranstransferase; TM0161, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MLY; 1.90A {Thermotoga maritima} Length = 284 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query136
3apz_A348 Geranyl diphosphate synthase; prenyltransferase, a 100.0
3mzv_A341 Decaprenyl diphosphate synthase; transferase, stru 100.0
3oyr_A345 Trans-isoprenyl diphosphate synthase; isoprenyl sy 100.0
3lmd_A360 Geranylgeranyl pyrophosphate synthase; isoprenyl d 100.0
3rmg_A334 Octaprenyl-diphosphate synthase; structural genomi 100.0
3pko_A334 Geranylgeranyl pyrophosphate synthase; isoprenyl d 100.0
3nf2_A352 Putative polyprenyl synthetase; isoprenyl diphosph 99.98
4dhd_A358 Polyprenyl synthetase; isoprenoid synthesis, isopr 99.97
1wy0_A342 Geranylgeranyl pyrophosphate synthetase; pyrococcu 99.97
3lk5_A380 Geranylgeranyl pyrophosphate synthase; structural 99.97
3aqb_B325 Component B of hexaprenyl diphosphate synthase; pr 99.97
1wmw_A330 Geranylgeranyl diphosphate synthetase; GGPP, preny 99.97
3tc1_A315 Octaprenyl pyrophosphate synthase; all alpha-helic 99.97
1yhl_A362 Farnesyl pyrophosphate synthase; farnesyl diphosph 99.96
2qis_A374 Farnesyl pyrophosphate synthetase; trans-prenyltra 99.96
1uby_A367 FPS, farnesyl diphosphate synthase; transferase, i 99.96
2ihi_A395 Pyrophosphate synthase; PV092040, structural genom 99.96
3dyh_A390 Farnesyl pyrophosphate synthase; protein-bisphosph 99.96
2e8v_A340 Geranylgeranyl pyrophosphate synthetase; prenyltra 99.96
2q80_A301 Geranylgeranyl pyrophosphate synthetase; isoprenoi 99.95
2her_A368 Fragment, farnesyl pyrophosphate synthase; farnesy 99.95
3mav_A395 Farnesyl pyrophosphate synthase; PV092040, structu 99.95
1rtr_A301 Geranyltranstransferase; 2.50A {Staphylococcus aur 99.94
1v4e_A299 Octoprenyl-diphosphate synthase; trans-type prenyl 99.94
3ts7_A324 Geranyltranstransferase; isoprenoid synthesis, far 99.94
4f62_A317 Geranyltranstransferase; enzyme function initiativ 99.94
3p8r_A302 Geranyltranstransferase; isoprenyl synthase, struc 99.93
3uca_A324 Geranyltranstransferase; isoprenoid synthesis, iso 99.93
3p8l_A302 Geranyltranstransferase; isoprenyl synthase, struc 99.93
3lsn_A304 Geranyltranstransferase; structural genomics, prot 99.93
2h8o_A335 Geranyltranstransferase; geranyltransferase,agroba 99.93
1rqj_A299 Geranyltranstransferase; bisphosphonate, isoprenyl 99.93
3lom_A313 Geranyltranstransferase; geranyltransferase, struc 99.93
3m0g_A297 Farnesyl diphosphate synthase; structural genomics 99.91
3pde_A309 Farnesyl-diphosphate synthase; isoprenyl diphospha 99.91
2ftz_A284 Geranyltranstransferase; TM0161, structural GE joi 99.9
2q58_A368 Fragment, farnesyl pyrophosphate synthase; farnesy 99.89
3llw_A311 Geranyltranstransferase (ISPA); structural genomic 99.88
3ipi_A295 Geranyltranstransferase; isoprene biosynthesis, he 99.88
3npk_A291 Geranyltranstransferase; isoprene biosynthesis, SG 99.86
2j1p_A293 Geranylgeranyl pyrophosphate synthetase; transfera 99.82
2azj_A289 Geranylgeranyl pyrophosphate synthetase; hexpps, t 99.8
4fp4_A285 Polyprenyl synthetase; isoprenoid synthesis, isopr 99.2
3qkc_B273 Geranyl diphosphate synthase small subunit; struct 98.78
3kra_B274 Geranyl diphosphate synthase small subunit; prenyl 98.76
3acx_A293 Dehydrosqualene synthase; CRTM, carotenoid biosynt 90.21
3rmg_A 334 Octaprenyl-diphosphate synthase; structural genomi 86.16
3nf2_A 352 Putative polyprenyl synthetase; isoprenyl diphosph 86.08
4hd1_A294 Squalene synthase HPNC; MCSG, structural genomics, 83.72
3mzv_A 341 Decaprenyl diphosphate synthase; transferase, stru 82.03
2q80_A 301 Geranylgeranyl pyrophosphate synthetase; isoprenoi 81.46
3vj8_A343 Squalene synthase; farnesyl-diphosphate farnesyltr 81.28
3aqb_B 325 Component B of hexaprenyl diphosphate synthase; pr 80.21
>3apz_A Geranyl diphosphate synthase; prenyltransferase, all alpha-helices fold, chroloplast, TRAN isoprenoid biosynthetic process; 2.60A {Arabidopsis thaliana} PDB: 3aq0_A* Back     alignment and structure
Probab=100.00  E-value=1.8e-32  Score=208.39  Aligned_cols=136  Identities=40%  Similarity=0.697  Sum_probs=127.0

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHhhhhhhcCCccccCCCCchhHhhCcccHHHHHHhhcCCcchHHHHhhcCChhh
Q psy5533           1 MLGGADDKLSEVAFEYGRNLGIAFQLVDDLLDFISSSDAMGKPTAADLKLGLATAPVLFACEKFPELNPMIMRRFQEPGD   80 (136)
Q Consensus         1 i~ag~~~~~~~~l~~~G~~lG~afQi~DDlld~~~~~~~~GK~~~~Di~~gk~Tlp~l~a~~~~~~~~~~l~~~~~~~~~   80 (136)
                      ++||++++..+.+++||.++|+||||+||++|++++++.+|||.|+|+++||+|+|+++|++..+.....+.+...++++
T Consensus       207 ~lag~~~~~~~~l~~~g~~lG~aFQi~DD~lD~~gd~~~~GK~~g~Dl~egK~Tlp~l~al~~~~~~~~~l~~~~~~~~~  286 (348)
T 3apz_A          207 VLTGQTAEVAVLAFEYGRNLGLAFQLIDDILDFTGTSASLGKGSLSDIRHGVITAPILFAMEEFPQLREVVDQVEKDPRN  286 (348)
T ss_dssp             HTTTCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTCTTCSCCHHHHTTCCCHHHHHHHHHCTTHHHHHHTTTTCTHH
T ss_pred             HHcCcCHHHHHHHHHHHHHHHHHHHHHHHHhhccCChhhcCCcchhhHhCCChhHHHHHHHHcCHHHHHHHHhccCCHHH
Confidence            36899999999999999999999999999999999999999999999999999999999999877777777776667789


Q ss_pred             HHHHHHHHHhcCHHHHHHHHHHHHHHHHHHHhhcCCCCH------HHHHHHHHHHHHHccCC
Q psy5533          81 VEKAFEFVHKSQGLEQTKFLARKHCVEAVRLASGLAESP------YQKGLVVLTDLVLNRMK  136 (136)
Q Consensus        81 ~~~i~~~i~~~g~~~~~~~~~~~~~~~A~~~l~~l~~~~------~~~~L~~l~~~~~~r~~  136 (136)
                      +.+++++|.++|+++++++.+++|.++|.+.|+.+|.++      .+..|..|++++.+|.+
T Consensus       287 ~~~~~~~i~~~g~l~~a~~~~~~~~~~A~~~L~~l~~~~~~~~~~~~~~L~~l~~~~~~R~~  348 (348)
T 3apz_A          287 VDIALEYLGKSKGIQRARELAMEHANLAAAAIGSLPETDNEDVKRSRRALIDLTHRVITRNK  348 (348)
T ss_dssp             HHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHTTSCCCCCHHHHHHHHHHHHHHHHHHHCCC
T ss_pred             HHHHHHHHHHcChHHHHHHHHHHHHHHHHHHHHcCCCCcccccHHHHHHHHHHHHHHHhCcC
Confidence            999999999999999999999999999999999999864      78999999999999975
>3mzv_A Decaprenyl diphosphate synthase; transferase, structural genomics, PSI-2, protein structure initiative; 1.90A {Rhodobacter capsulatus} Back     alignment and structure
>3oyr_A Trans-isoprenyl diphosphate synthase; isoprenyl synthase, PSI, protein structure initiative; HET: IPE; 2.00A {Caulobacter crescentus} Back     alignment and structure
>3lmd_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, protein structure initiative, nysgrc; 1.90A {Corynebacterium glutamicum} PDB: 3q2q_A* Back     alignment and structure
>3rmg_A Octaprenyl-diphosphate synthase; structural genomics, protein structure initiative, isoprene biosynthesis, transferase; 2.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3pko_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; HET: CIT; 1.98A {Lactobacillus brevis} PDB: 3n3d_A Back     alignment and structure
>3nf2_A Putative polyprenyl synthetase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; 2.20A {Streptomyces coelicolor} Back     alignment and structure
>4dhd_A Polyprenyl synthetase; isoprenoid synthesis, isoprenoid diphosphate synthase, trans; 1.65A {Pyrobaculum calidifontis} PDB: 4gp1_A* 4gp2_A* Back     alignment and structure
>1wy0_A Geranylgeranyl pyrophosphate synthetase; pyrococcus horikosh structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3lk5_A Geranylgeranyl pyrophosphate synthase; structural genomics, protein structure initiative, geranylge pyrophosphate synthase; 1.90A {Corynebacterium glutamicum} PDB: 3qqv_A* Back     alignment and structure
>3aqb_B Component B of hexaprenyl diphosphate synthase; prenyltransferase, transferase; 2.40A {Micrococcus luteus} PDB: 3aqc_B* Back     alignment and structure
>1wmw_A Geranylgeranyl diphosphate synthetase; GGPP, prenyl diphosphate synthase, structural genom riken structural genomics/proteomics initiative; 1.55A {Thermus thermophilus} Back     alignment and structure
>3tc1_A Octaprenyl pyrophosphate synthase; all alpha-helices fold, transferase; 2.00A {Helicobacter pylori} Back     alignment and structure
>1yhl_A Farnesyl pyrophosphate synthase; farnesyl diphosphate synthase, bisphosphonate, dimethyl ALLY pyrophosphate sulfate, FPPS, transferase; HET: DMA RIS; 1.95A {Trypanosoma cruzi} PDB: 1yhk_A* 1yhm_A* 3iba_A* 3ick_A* 3icm_A* 3icn_A* 3icz_A* 3id0_A* Back     alignment and structure
>2qis_A Farnesyl pyrophosphate synthetase; trans-prenyltransferase, structural genomics, structural GEN consortium, SGC, transferase; HET: RIS; 1.80A {Homo sapiens} PDB: 4dem_F* 1yv5_A* 1yq7_A* 2opm_A* 2opn_A* 3cp6_A* 2rah_A* 2vf6_A* 1zw5_A* 3b7l_A* 3s4j_A* 3rye_A* 3n45_F* 2f89_F* 2f7m_F* 2f8z_F* 2f8c_F* 2f92_F* 2f9k_F* 3n1v_F* ... Back     alignment and structure
>1uby_A FPS, farnesyl diphosphate synthase; transferase, isoprene biosynthesis, cholesterol biosynthesis; HET: DMA; 2.40A {Gallus gallus} SCOP: a.128.1.1 PDB: 1ubw_A* 1ubv_A* 1ubx_A* 1fps_A Back     alignment and structure
>3dyh_A Farnesyl pyrophosphate synthase; protein-bisphosphonate complex, isoprene biosynthesis, transferase; HET: 721; 1.94A {Trypanosoma brucei} PDB: 2ewg_A* 2i19_A* 2p1c_A* 3dyf_A* 3dyg_A* 2ogd_A* 3efq_A* 3egt_A* Back     alignment and structure
>2e8v_A Geranylgeranyl pyrophosphate synthetase; prenyltransferase, farnesyl pyrophosphate, bisphosphonate; HET: GRG; 1.80A {Saccharomyces cerevisiae} PDB: 2e8t_A* 2e8u_A* 2dh4_A* 2e8w_A* 2e8x_A* 2e90_A* 2e91_A* 2e92_A* 2e93_A* 2e94_A* 2e95_A* 2z4v_A* 2z4w_A* 2z4x_A* 2z4y_A* 2z4z_A* 2z50_A* 2z52_A* 2z78_A* 2z7h_A* ... Back     alignment and structure
>2q80_A Geranylgeranyl pyrophosphate synthetase; isoprenoid pathway, isopentenyl transferase, structural GENO structural genomics consortium, SGC; HET: GRG; 2.70A {Homo sapiens} SCOP: a.128.1.1 Back     alignment and structure
>3mav_A Farnesyl pyrophosphate synthase; PV092040, structural genomics, structural genomics consortium, SGC, transferase, isoprene biosynthesis; 2.10A {Plasmodium vivax} PDB: 3cc9_A* 3ez3_A* 3ldw_A* 3mys_A* 3ph7_A* 3rbm_A* 3ryw_A* Back     alignment and structure
>1rtr_A Geranyltranstransferase; 2.50A {Staphylococcus aureus} SCOP: a.128.1.1 Back     alignment and structure
>1v4e_A Octoprenyl-diphosphate synthase; trans-type prenyltransferase, thermophilic; 2.28A {Thermotoga maritima} SCOP: a.128.1.1 PDB: 1v4j_A 1wkz_A 1vg2_A 1wl3_A 1wl0_A 1wl2_A 1v4h_A 1v4i_A 1v4k_A 2azl_A 1wl1_A 1vg4_A 1vg3_A 1vg6_A 1vg7_A Back     alignment and structure
>3ts7_A Geranyltranstransferase; isoprenoid synthesis, farnesyl diphosphate synthase; 1.94A {Methylococcus capsulatus} Back     alignment and structure
>4f62_A Geranyltranstransferase; enzyme function initiative, structural genomics; 2.10A {Marinomonas SP} Back     alignment and structure
>3p8r_A Geranyltranstransferase; isoprenyl synthase, structural genomics, PSI, protein struct initiative, nysgrc; 2.50A {Vibrio cholerae} SCOP: a.128.1.1 Back     alignment and structure
>3uca_A Geranyltranstransferase; isoprenoid synthesis, isoprenoid diphosphate synthase; 2.00A {Clostridium perfringens} Back     alignment and structure
>3p8l_A Geranyltranstransferase; isoprenyl synthase, structural genomics, PSI, protein struct initiative, nysgrc; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3lsn_A Geranyltranstransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; HET: MSE; 1.35A {Pseudomonas fluorescens} PDB: 3lji_A* 3p41_A* Back     alignment and structure
>2h8o_A Geranyltranstransferase; geranyltransferase,agrobacterium tumefaciens, structural GEN PSI-2, protein structure initiative; 1.60A {Agrobacterium tumefaciens} Back     alignment and structure
>1rqj_A Geranyltranstransferase; bisphosphonate, isoprenyl synthase; HET: IPR RIS; 1.95A {Escherichia coli} SCOP: a.128.1.1 PDB: 1rqi_A* 2for_A* Back     alignment and structure
>3lom_A Geranyltranstransferase; geranyltransferase, structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>3m0g_A Farnesyl diphosphate synthase; structural genomics, protein structure initiative, NYSGXRC, biosynthesis, transferase, PSI-2; 1.90A {Rhodobacter capsulatus} PDB: 3lvs_A Back     alignment and structure
>3pde_A Farnesyl-diphosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative; HET: IPE; 1.75A {Lactobacillus brevis} PDB: 3m9u_A* Back     alignment and structure
>2ftz_A Geranyltranstransferase; TM0161, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MLY; 1.90A {Thermotoga maritima} Back     alignment and structure
>2q58_A Fragment, farnesyl pyrophosphate synthase; farnesyl diphosphate synthase, structural genomics, structur genomics consortium, SGC; HET: ZOL; 2.37A {Cryptosporidium parvum} PDB: 2o1o_A* Back     alignment and structure
>3llw_A Geranyltranstransferase (ISPA); structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Helicobacter pylori} PDB: 3q1o_A* Back     alignment and structure
>3ipi_A Geranyltranstransferase; isoprene biosynthesis, helical bundle, protein structure initiative II (PSI II), structural genomics, nysgxrc; 1.90A {Methanosarcina mazei} Back     alignment and structure
>3npk_A Geranyltranstransferase; isoprene biosynthesis, SGX, structural genomics protein structure initiative; 1.50A {Campylobacter jejuni} Back     alignment and structure
>2j1p_A Geranylgeranyl pyrophosphate synthetase; transferase, isoprene biosynthesis, multifunctional enzyme, carotenoid biosynthesis; HET: GRG; 1.8A {Sinapis alba} PDB: 2j1o_A 3kra_A 3krc_A* 3krf_A* 3kro_A* 3krp_A* 3oab_A* 3oac_A* Back     alignment and structure
>2azj_A Geranylgeranyl pyrophosphate synthetase; hexpps, trans-prenyltransferase; 2.40A {Sulfolobus solfataricus} PDB: 2azk_A Back     alignment and structure
>4fp4_A Polyprenyl synthetase; isoprenoid synthesis, isoprenoid diphosphate synthase, trans; HET: GER UNL; 2.00A {Pyrobaculum calidifontis} Back     alignment and structure
>3qkc_B Geranyl diphosphate synthase small subunit; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.20A {Antirrhinum majus} Back     alignment and structure
>3kra_B Geranyl diphosphate synthase small subunit; prenyltransferase, isoprene biosynthesis, isoprenyl pyrophosphate synthase, transferase; 1.90A {Mentha x piperita} PDB: 3krc_B* 3krf_B* 3kro_B* 3krp_B* 3oab_B* 3oac_B* Back     alignment and structure
>3acx_A Dehydrosqualene synthase; CRTM, carotenoid biosynthesis, staphyloxanthin biosynthesis, transferase, head-TO-head condensation, inhibitor; HET: 673; 1.31A {Staphylococcus aureus} PDB: 2zcp_A* 2zcq_A* 2zcr_A* 2zcs_A* 2zy1_A* 3acw_A* 2zco_A* 3acy_A* 3npr_A* 3nri_A* 3tfn_A* 3tfp_A* 3tfv_A* 3adz_A* 3lgz_B* 3vjd_A* 3vje_A* 3ae0_A* 4ea2_A* 4e9u_A* ... Back     alignment and structure
>3rmg_A Octaprenyl-diphosphate synthase; structural genomics, protein structure initiative, isoprene biosynthesis, transferase; 2.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3nf2_A Putative polyprenyl synthetase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; 2.20A {Streptomyces coelicolor} Back     alignment and structure
>4hd1_A Squalene synthase HPNC; MCSG, structural genomics, PSI-biology, midwest center for S genomics, transferase; 2.40A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3mzv_A Decaprenyl diphosphate synthase; transferase, structural genomics, PSI-2, protein structure initiative; 1.90A {Rhodobacter capsulatus} Back     alignment and structure
>2q80_A Geranylgeranyl pyrophosphate synthetase; isoprenoid pathway, isopentenyl transferase, structural GENO structural genomics consortium, SGC; HET: GRG; 2.70A {Homo sapiens} SCOP: a.128.1.1 Back     alignment and structure
>3vj8_A Squalene synthase; farnesyl-diphosphate farnesyltransferase, head-TO-head synth cholesterol biosynthesis, oxidoreductase, transferase; 1.52A {Homo sapiens} PDB: 3vj9_A 3vja_A 3vjb_A 3vjc_A* 3v66_A* 3lee_A* 3q2z_A* 3q30_A* 3asx_A* 1ezf_A* Back     alignment and structure
>3aqb_B Component B of hexaprenyl diphosphate synthase; prenyltransferase, transferase; 2.40A {Micrococcus luteus} PDB: 3aqc_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 136
d1v4ea_280 a.128.1.1 (A:) Octoprenyl-diphosphate synthase {Th 3e-12
d2q80a1291 a.128.1.1 (A:6-296) Geranylgeranyl pyrophosphate s 4e-12
d1rqja_299 a.128.1.1 (A:) Farnesyl diphosphate synthase (gera 2e-04
d1rtra_290 a.128.1.1 (A:) Farnesyl diphosphate synthase (gera 5e-04
>d1v4ea_ a.128.1.1 (A:) Octoprenyl-diphosphate synthase {Thermotoga maritima [TaxId: 2336]} Length = 280 Back     information, alignment and structure

class: All alpha proteins
fold: Terpenoid synthases
superfamily: Terpenoid synthases
family: Isoprenyl diphosphate synthases
domain: Octoprenyl-diphosphate synthase
species: Thermotoga maritima [TaxId: 2336]

 Score = 59.7 bits (143), Expect = 3e-12
 Identities = 28/117 (23%), Positives = 49/117 (41%), Gaps = 6/117 (5%)

Query: 1   MLGGADDKLSEVAFEYGRNLGIAFQLVDDLLDFISSSDAMGKPTAADLKLGLATAPVLFA 60
           +    + +L E  +  G  +G  +Q+ DD++DF             DLK G+A+ P++ A
Sbjct: 169 LPALLEGELGEDLYNLGVTIGTIYQMFDDIMDFAGMEKIGKDGF-LDLKNGVASFPLVTA 227

Query: 61  CEKFPELNPMIMRRFQEPGDVEKAFEFVHKSQGLEQTKFLARKHCVEAVRLASGLAE 117
            EKFPE   M   R     D      F+ +   L++ +   +      +   S L +
Sbjct: 228 MEKFPEARQMFENR-----DWSGLMSFMREKGILKECEETLKVLVKNVIIENSWLRD 279
>d2q80a1 a.128.1.1 (A:6-296) Geranylgeranyl pyrophosphate synthetase {Human (Homo sapiens) [TaxId: 9606]} Length = 291 Back     information, alignment and structure
>d1rqja_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Escherichia coli [TaxId: 562]} Length = 299 Back     information, alignment and structure
>d1rtra_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Staphylococcus aureus [TaxId: 1280]} Length = 290 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query136
d1fpsa_348 Farnesyl diphosphate synthase (geranyltranstransfe 99.96
d2q80a1291 Geranylgeranyl pyrophosphate synthetase {Human (Ho 99.95
d1rtra_290 Farnesyl diphosphate synthase (geranyltranstransfe 99.9
d1rqja_299 Farnesyl diphosphate synthase (geranyltranstransfe 99.9
d1v4ea_280 Octoprenyl-diphosphate synthase {Thermotoga mariti 99.88
d1ezfa_333 Squalene synthase {Human (Homo sapiens) [TaxId: 96 92.88
d2q80a1 291 Geranylgeranyl pyrophosphate synthetase {Human (Ho 85.89
>d1fpsa_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
class: All alpha proteins
fold: Terpenoid synthases
superfamily: Terpenoid synthases
family: Isoprenyl diphosphate synthases
domain: Farnesyl diphosphate synthase (geranyltranstransferase)
species: Chicken (Gallus gallus) [TaxId: 9031]

Probab=99.96  E-value=2e-29  Score=189.93  Aligned_cols=134  Identities=17%  Similarity=0.171  Sum_probs=121.4

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHhhhhhhcCCccccCCCCchhHhhCcccHHHHHHhhcCCc-chHHHHhhc--CCh
Q psy5533           2 LGGADDKLSEVAFEYGRNLGIAFQLVDDLLDFISSSDAMGKPTAADLKLGLATAPVLFACEKFPE-LNPMIMRRF--QEP   78 (136)
Q Consensus         2 ~ag~~~~~~~~l~~~G~~lG~afQi~DDlld~~~~~~~~GK~~~~Di~~gk~Tlp~l~a~~~~~~-~~~~l~~~~--~~~   78 (136)
                      +++++++..+.++.||.++|+||||+||++|++++++.+|| .|+||.+||+|+|++++++..++ .+..+....  .++
T Consensus       212 ~~~~~~~~~~~l~~~g~~lGiaFQI~DDilD~~gd~~~~GK-~g~Dl~egK~Tlpii~al~~~~~~~r~~l~~~~~~~~~  290 (348)
T d1fpsa_         212 VGIDSKEEHENAKAILLEMGEYFQIQDDYLDCFGDPALTGK-VGTDIQDNKCSWLVVQCLQRVTPEQRQLLEDNYGRKEP  290 (348)
T ss_dssp             TTCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCSSCCSS-CSCCCSSCCCCHHHHHHHHTCCHHHHHHHHHHSSSSCH
T ss_pred             hhhccccchhhccccccccchHHHHHHHHhhhhcchhccCc-ccccccCCccHHHHHHHHHhCCHHHHHHHHHHhCCCCH
Confidence            45788999999999999999999999999999999999999 79999999999999999999875 344454332  367


Q ss_pred             hhHHHHHHHHHhcCHHHHHHHHHHHHHHHHHHHhhcCCCCHHHHHHHHHHHHHHccCC
Q psy5533          79 GDVEKAFEFVHKSQGLEQTKFLARKHCVEAVRLASGLAESPYQKGLVVLTDLVLNRMK  136 (136)
Q Consensus        79 ~~~~~i~~~i~~~g~~~~~~~~~~~~~~~A~~~l~~l~~~~~~~~L~~l~~~~~~r~~  136 (136)
                      ++++++++++..+|+++++++.++.+.++|.+.|+.+|++..++.|..|++++++|.|
T Consensus       291 e~i~~v~~~i~~~g~~~~~~~~~~~~~~~a~~~l~~~~~~~~~~~L~~l~~~i~~R~k  348 (348)
T d1fpsa_         291 EKVAKVKELYEAVGMRAAFQQYEESSYRRLQELIEKHSNRLPKEIFLGLAQKIYKRQK  348 (348)
T ss_dssp             HHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHTTTCSSSCTHHHHHHHHHHSCCCC
T ss_pred             HHHHHHHHHHHHCChHHHHHHHHHHHHHHHHHHHHcCCCcHHHHHHHHHHHHHHhCCC
Confidence            7899999999999999999999999999999999999998889999999999999986
>d2q80a1 a.128.1.1 (A:6-296) Geranylgeranyl pyrophosphate synthetase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rtra_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1rqja_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v4ea_ a.128.1.1 (A:) Octoprenyl-diphosphate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ezfa_ a.128.1.2 (A:) Squalene synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q80a1 a.128.1.1 (A:6-296) Geranylgeranyl pyrophosphate synthetase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure