Diaphorina citri psyllid: psy5554

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270--

MPPIVAPISTKGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLIVPKSKRGAQENASRSENEPCLVKIKFTPNL

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

*PPIVAPISTKGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLIVPKS*************EPCLVK**F****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005618 [CC]	cell wall	probable	GO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0016020 [CC]	membrane	probable	GO:0005575
GO:0043232 [CC]	intracellular non-membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0032991 [CC]	macromolecular complex	probable	GO:0005575
GO:0006950 [BP]	response to stress	probable	GO:0050896, GO:0008150
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0003690 [MF]	double-stranded DNA binding	probable	GO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0003697 [MF]	single-stranded DNA binding	probable	GO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0032508 [BP]	DNA duplex unwinding	probable	GO:0071103, GO:0032392, GO:0044238, GO:0044260, GO:0006139, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0006259, GO:1901360, GO:0046483
GO:0010501 [BP]	RNA secondary structure unwinding	probable	GO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0052553 [BP]	modulation by symbiont of host immune response	probable	GO:0052552, GO:0050896, GO:0048583, GO:0052572, GO:0065007, GO:0052200, GO:0050789, GO:0031347, GO:0075136, GO:0052031, GO:0044419, GO:0051817, GO:0002682, GO:0065008, GO:0052564, GO:0008150, GO:0052255, GO:0051701, GO:0051707, GO:0044003, GO:0051704, GO:0052173, GO:0050776, GO:0009607, GO:0080134, GO:0044403, GO:0035821
GO:0003723 [MF]	RNA binding	probable	GO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0005576 [CC]	extracellular region	probable	GO:0005575

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PSS, chain A
Confidence level:probable
Coverage over the Query: 47-250
View the alignment between query and template
View the model in PyMOL

Template: 2W7Z, chain A
Confidence level:probable
Coverage over the Query: 13-191
View the alignment between query and template
View the model in PyMOL