Diaphorina citri psyllid: psy5555

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-----

MDMRRHYSGPRKQEDVERLNVLYEQNWTTLVTEQLRRFESNVIEMSSQLGYNGRDPADKDRQWSFSGALLYSVTVITTIGYGNLAPKTPIGKIVTMVYALFGIPLMLLCISNLGSLLADTFQFTYSHSCCASRQKSGYICIGAGVFAAWEEWSFLDGAYFCFVTLSTIGFGDLVPGKSFQRTDTQ

ccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEEEEcccccccccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEcccccccccEEEEEEEcccccccccccccccccccccc

********GPRKQEDVERLNVLYEQNWTTLVTEQLRRFESNVIEMSSQLGYNGRDPADKDRQWSFSGALLYSVTVITTIGYGNLAPKTPIGKIVTMVYALFGIPLMLLCISNLGSLLADTFQFTYSHSCCASRQKSGYICIGAGVFAAWEEWSFLDGAYFCFVTLSTIGFGDLVP**********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDMRRHYSGPRKQEDVERLNVLYEQNWTTLVTEQLRRFESNVIEMSSQLGYNGRDPADKDRQWSFSGALLYSVTVITTIGYGNLAPKTPIGKIVTMVYALFGIPLMLLCISNLGSLLADTFQFTYSHSCCASRQKSGYICIGAGVFAAWEEWSFLDGAYFCFVTLSTIGFGDLVPGKSFQRTDTQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0006813 [BP]	potassium ion transport	probable	GO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0030001, GO:0008150, GO:0051234, GO:0015672, GO:0044699
GO:0005216 [MF]	ion channel activity	probable	GO:0022891, GO:0022892, GO:0005215, GO:0015075, GO:0022857, GO:0015267, GO:0003674, GO:0022803, GO:0022838

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UM7, chain A
Confidence level:very confident
Coverage over the Query: 17-182
View the alignment between query and template
View the model in PyMOL