Psyllid ID: psy5555

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-----
MDMRRHYSGPRKQEDVERLNVLYEQNWTTLVTEQLRRFESNVIEMSSQLGYNGRDPADKDRQWSFSGALLYSVTVITTIGYGNLAPKTPIGKIVTMVYALFGIPLMLLCISNLGSLLADTFQFTYSHSCCASRQKSGYICIGAGVFAAWEEWSFLDGAYFCFVTLSTIGFGDLVPGKSFQRTDTQ
ccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEEEEEcccccccccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEcccccccccEEEEEEEcccccccccccccccccccccc
cccHccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHEEEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEHHHHHHHHccccHHHEEEEEEEEHHHccccccEccccccccccc
mdmrrhysgprkqeDVERLNVLYEQNWTTLVTEQLRRFESNVIEMssqlgyngrdpadkdrqwsfsgaLLYSVTVITtigygnlapktpigKIVTMVYALFGIPLMLLCISNLGslladtfqftyshsccasrqksgyiCIGAGVFAAWEEwsfldgayfcfvtlstigfgdlvpgksfqrtdtq
mdmrrhysgprkqedverLNVLYEQNWTTLVTEQLRRFESNVIEMSSQLGYNGRDPADKDRQWSFSGALLYSVTVITTIGygnlapktpIGKIVTMVYALFGIPLMLLCISNLGSLLADTFQFTYSHSCCASRQKSGYICIGAGVFAAWEEWSFLDGAYFCFVTLSTIgfgdlvpgksfqrtdtq
MDMRRHYSGPRKQEDVERLNVLYEQNWTTLVTEQLRRFESNVIEMSSQLGYNGRDPADKDRQWSFSGALLYSVTVITTIGYGNLAPKTPIGKIVTMVYALFGIPLMLLCISNLGSLLADTFQFTYSHSCCASRQKSGYICIGAGVFAAWEEWSFLDGAYFCFVTLSTIGFGDLVPGKSFQRTDTQ
*****************RLNVLYEQNWTTLVTEQLRRFESNVIEMS**LGY*********RQWSFSGALLYSVTVITTIGYGNLAPKTPIGKIVTMVYALFGIPLMLLCISNLGSLLADTFQFTYSHSCCASRQKSGYICIGAGVFAAWEEWSFLDGAYFCFVTLSTIGFGDLVP**********
***R***SGPRKQEDVERLNVLYEQNWTTLVTEQLRRFESNVIEMSSQLGYNGRDPADKDRQWSFSGALLYSVTVITTIGYGNLAPKTPIGKIVTMVYALFGIPLMLLCISNLGSLLADTFQFTYSHSCCASRQKSGYICIGAGVFAAWEEWSFLDGAYFCFVTLSTIGFGDL************
*************EDVERLNVLYEQNWTTLVTEQLRRFESNVIEMSSQLGYNGRDPADKDRQWSFSGALLYSVTVITTIGYGNLAPKTPIGKIVTMVYALFGIPLMLLCISNLGSLLADTFQFTYSHSCCASRQKSGYICIGAGVFAAWEEWSFLDGAYFCFVTLSTIGFGDLVPGKSFQRTDTQ
*****HY*GPRKQEDVERLNVLYEQNWTTLVTEQLRRFESNVIEMSSQLGYNGR****KDRQWSFSGALLYSVTVITTIGYGNLAPKTPIGKIVTMVYALFGIPLMLLCISNLGSLLADTFQFTYSHSCCASRQKSGYICIGAGVFAAWEEWSFLDGAYFCFVTLSTIGFGDLVPGKS*******
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDMRRHYSGPRKQEDVERLNVLYEQNWTTLVTEQLRRFESNVIEMSSQLGYNGRDPADKDRQWSFSGALLYSVTVITTIGYGNLAPKTPIGKIVTMVYALFGIPLMLLCISNLGSLLADTFQFTYSHSCCASRQKSGYICIGAGVFAAWEEWSFLDGAYFCFVTLSTIGFGDLVPGKSFQRTDTQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query185 2.2.26 [Sep-21-2011]
Q9JL58 365 Potassium channel subfami yes N/A 0.854 0.432 0.335 1e-23
Q63ZI0 374 Potassium channel subfami N/A N/A 0.648 0.320 0.394 2e-23
Q9NPC2 374 Potassium channel subfami yes N/A 0.648 0.320 0.401 2e-23
Q3LS21 402 Potassium channel subfami yes N/A 0.648 0.298 0.386 8e-23
Q9ES08 396 Potassium channel subfami yes N/A 0.670 0.313 0.382 8e-23
O14649 394 Potassium channel subfami no N/A 0.675 0.317 0.363 1e-21
O54912 411 Potassium channel subfami no N/A 0.708 0.318 0.371 1e-21
O35111 409 Potassium channel subfami no N/A 0.708 0.320 0.371 1e-21
Q9H427 330 Potassium channel subfami no N/A 0.670 0.375 0.366 1e-19
O17185 329 Two pore potassium channe no N/A 0.643 0.361 0.392 3e-19
>sp|Q9JL58|KCNK9_CAVPO Potassium channel subfamily K member 9 OS=Cavia porcellus GN=KCNK9 PE=1 SV=1 Back     alignment and function desciption
 Score =  108 bits (271), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 62/185 (33%), Positives = 92/185 (49%), Gaps = 27/185 (14%)

Query: 11  RKQEDVERLNVLYEQNWTTLVTEQLRRFESNVIEMSSQLGYNGRDPADKDRQWSFSGALL 70
           R++E ++   +     +  + TE  R+ E  +++          +P     QW F+G+  
Sbjct: 36  REEEKLKAEEIRIRGKYN-ISTEDYRQLELVILQ---------SEPHRAGVQWKFAGSFY 85

Query: 71  YSVTVITTIGYGNLAPKTPIGKIVTMVYALFGIPLMLLCISNLGSLLADTFQFTYSH--S 128
           +++TVITTIGYG+ AP T  GK   M YA+ GIPL L+   +LG  +    ++       
Sbjct: 86  FAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRIKK 145

Query: 129 CCASRQKS---------------GYICIGAGVFAAWEEWSFLDGAYFCFVTLSTIGFGDL 173
           CC  R                  G +CIGA  F+  EEWSF    Y+CF+TL+TIGFGD 
Sbjct: 146 CCGMRNTEVSMENMVTVGFFSCMGTLCIGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDY 205

Query: 174 VPGKS 178
           V  +S
Sbjct: 206 VALQS 210
pH-dependent, voltage-insensitive, background potassium channel protein.
Cavia porcellus (taxid: 10141)
>sp|Q63ZI0|KCNK9_XENLA Potassium channel subfamily K member 9 OS=Xenopus laevis GN=kcnk9 PE=2 SV=1 Back     alignment and function description
>sp|Q9NPC2|KCNK9_HUMAN Potassium channel subfamily K member 9 OS=Homo sapiens GN=KCNK9 PE=1 SV=1 Back     alignment and function description
>sp|Q3LS21|KCNK9_MOUSE Potassium channel subfamily K member 9 OS=Mus musculus GN=Kcnk9 PE=2 SV=1 Back     alignment and function description
>sp|Q9ES08|KCNK9_RAT Potassium channel subfamily K member 9 OS=Rattus norvegicus GN=Kcnk9 PE=1 SV=2 Back     alignment and function description
>sp|O14649|KCNK3_HUMAN Potassium channel subfamily K member 3 OS=Homo sapiens GN=KCNK3 PE=1 SV=1 Back     alignment and function description
>sp|O54912|KCNK3_RAT Potassium channel subfamily K member 3 OS=Rattus norvegicus GN=Kcnk3 PE=2 SV=1 Back     alignment and function description
>sp|O35111|KCNK3_MOUSE Potassium channel subfamily K member 3 OS=Mus musculus GN=Kcnk3 PE=2 SV=2 Back     alignment and function description
>sp|Q9H427|KCNKF_HUMAN Potassium channel subfamily K member 15 OS=Homo sapiens GN=KCNK15 PE=1 SV=2 Back     alignment and function description
>sp|O17185|SUP9_CAEEL Two pore potassium channel protein sup-9 OS=Caenorhabditis elegans GN=sup-9 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query185
391327180 348 PREDICTED: potassium channel subfamily K 0.870 0.462 0.482 3e-45
328717441 439 PREDICTED: hypothetical protein LOC10016 0.616 0.259 0.686 2e-39
443703206 330 hypothetical protein CAPTEDRAFT_24139, p 0.908 0.509 0.362 1e-32
405958434 358 TWiK family of potassium channels protei 0.967 0.5 0.341 2e-32
158298009 391 AGAP004718-PA [Anopheles gambiae str. PE 0.864 0.409 0.401 4e-31
322792773 341 hypothetical protein SINV_01478 [Solenop 0.875 0.475 0.387 6e-31
241690379 423 hypothetical protein IscW_ISCW010334 [Ix 0.589 0.257 0.549 3e-30
427798815 329 Putative lateral inhibition, partial [Rh 0.594 0.334 0.535 5e-30
19921934 918 CG1688 [Drosophila melanogaster] gi|5052 0.616 0.124 0.514 6e-30
195124501 956 GI21227 [Drosophila mojavensis] gi|19391 0.729 0.141 0.444 1e-29
>gi|391327180|ref|XP_003738083.1| PREDICTED: potassium channel subfamily K member 3-like [Metaseiulus occidentalis] Back     alignment and taxonomy information
 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 124/197 (62%), Gaps = 36/197 (18%)

Query: 17  ERLNVLYEQNWTTLVTEQLRRFESNVIEMSSQLGYNGRDPADKDRQWSFSGALLYSVTVI 76
           ERLNV     W   V  +LR++E +V++     GY+G D +D+  QW+FSGALLY +TVI
Sbjct: 89  ERLNVFERARWIRAVESRLRKYEEDVVKAVRDNGYDGND-SDQPVQWTFSGALLYCITVI 147

Query: 77  TTIGYGNLAPKTPIGKIVTMVYALFGIPLMLLCISNLGSLLADTFQFTYSHSCC------ 130
           TTIGYG++APKT  GK+VT++YAL GIPLMLLC+SN+G++LA +F+F YS  CC      
Sbjct: 148 TTIGYGHIAPKTNEGKVVTILYALVGIPLMLLCLSNIGNVLAGSFRFAYSKMCCLCIIPP 207

Query: 131 -----------ASRQKS------------------GYICIGAGVFAAWEEWSFLDGAYFC 161
                       S   S                   YIC+GA +F+ WE W+ L+GAYFC
Sbjct: 208 QPRSMLPNGFEGSSPNSVSVAPARIPVCLVMLFVASYICVGAVIFSKWEGWTILNGAYFC 267

Query: 162 FVTLSTIGFGDLVPGKS 178
           F+TLSTIGFGD VPG+S
Sbjct: 268 FITLSTIGFGDYVPGQS 284

Source: Metaseiulus occidentalis

Species: Metaseiulus occidentalis

Genus: Metaseiulus

Family: Phytoseiidae

Order: Mesostigmata

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328717441|ref|XP_001952545.2| PREDICTED: hypothetical protein LOC100167612 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|443703206|gb|ELU00882.1| hypothetical protein CAPTEDRAFT_24139, partial [Capitella teleta] Back     alignment and taxonomy information
>gi|405958434|gb|EKC24562.1| TWiK family of potassium channels protein 7 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|158298009|ref|XP_318112.4| AGAP004718-PA [Anopheles gambiae str. PEST] gi|157014602|gb|EAA13189.5| AGAP004718-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|322792773|gb|EFZ16606.1| hypothetical protein SINV_01478 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|241690379|ref|XP_002401935.1| hypothetical protein IscW_ISCW010334 [Ixodes scapularis] gi|215504598|gb|EEC14092.1| hypothetical protein IscW_ISCW010334 [Ixodes scapularis] Back     alignment and taxonomy information
>gi|427798815|gb|JAA64859.1| Putative lateral inhibition, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|19921934|ref|NP_610516.1| CG1688 [Drosophila melanogaster] gi|5052538|gb|AAD38599.1|AF145624_1 BcDNA.GH04802 [Drosophila melanogaster] gi|7303857|gb|AAF58903.1| CG1688 [Drosophila melanogaster] gi|220943664|gb|ACL84375.1| CG1688-PA [synthetic construct] Back     alignment and taxonomy information
>gi|195124501|ref|XP_002006731.1| GI21227 [Drosophila mojavensis] gi|193911799|gb|EDW10666.1| GI21227 [Drosophila mojavensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query185
FB|FBgn0027589 918 CG1688 [Drosophila melanogaste 0.454 0.091 0.6 1.2e-47
WB|WBGene00010784 372 twk-48 [Caenorhabditis elegans 0.589 0.293 0.495 8.3e-39
FB|FBgn0035192 729 CG9194 [Drosophila melanogaste 0.589 0.149 0.436 2.8e-37
WB|WBGene00006690 676 twk-39 [Caenorhabditis elegans 0.627 0.171 0.431 5.7e-35
FB|FBgn0260971 1009 CG42594 [Drosophila melanogast 0.427 0.078 0.512 1.6e-33
FB|FBgn0033257 395 CG8713 [Drosophila melanogaste 0.367 0.172 0.602 1.7e-33
FB|FBgn0038621 389 CG10864 [Drosophila melanogast 0.670 0.318 0.389 3.8e-32
FB|FBgn0259242 484 CG42340 [Drosophila melanogast 0.551 0.210 0.4 1.5e-26
WB|WBGene00006691 436 twk-40 [Caenorhabditis elegans 0.578 0.245 0.368 1.7e-25
UNIPROTKB|G3V9Y8 392 Kcnk3 "Potassium channel subfa 0.583 0.275 0.376 8e-24
FB|FBgn0027589 CG1688 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 263 (97.6 bits), Expect = 1.2e-47, Sum P(3) = 1.2e-47
 Identities = 51/85 (60%), Positives = 64/85 (75%)

Query:    46 SSQLGYNGRDPADKDRQWSFSGALLYSVTVITTIGYGNLAPKTPIGKIVTMVYALFGIPL 105
             +S LG+ G D  D  + WSFS ALLYSVTVITTIG+G+L P+T  GK+ T+ YAL G+PL
Sbjct:   175 ASALGHFGYDAGDS-QSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPL 233

Query:   106 MLLCISNLGSLLADTFQFTYSHSCC 130
             ML+C+S+LG+LLAD  Q TY   CC
Sbjct:   234 MLMCLSSLGALLADGLQCTYVRLCC 258
GO:0005267 "potassium channel activity" evidence=ISS
GO:0071805 "potassium ion transmembrane transport" evidence=IEA
GO:0016020 "membrane" evidence=IEA
WB|WBGene00010784 twk-48 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0035192 CG9194 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00006690 twk-39 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0260971 CG42594 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0033257 CG8713 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038621 CG10864 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0259242 CG42340 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00006691 twk-40 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|G3V9Y8 Kcnk3 "Potassium channel subfamily K member 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
pfam0788574 pfam07885, Ion_trans_2, Ion channel 2e-18
pfam0788574 pfam07885, Ion_trans_2, Ion channel 3e-09
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 8e-04
>gnl|CDD|219619 pfam07885, Ion_trans_2, Ion channel Back     alignment and domain information 
 Score = 74.9 bits (185), Expect = 2e-18
 Identities = 25/54 (46%), Positives = 35/54 (64%)

Query: 61  RQWSFSGALLYSVTVITTIGYGNLAPKTPIGKIVTMVYALFGIPLMLLCISNLG 114
             W F  AL +S   +TTIGYG++ P T  G++ T++Y L GIPL LL ++ LG
Sbjct: 21  WGWDFLDALYFSFVTLTTIGYGDIVPLTDAGRLFTIIYILIGIPLFLLFLAVLG 74

This family includes the two membrane helix type ion channels found in bacteria. Length = 74
>gnl|CDD|219619 pfam07885, Ion_trans_2, Ion channel Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 185
KOG4404|consensus 350 100.0
KOG1418|consensus 433 99.96
KOG3713|consensus477 99.44
PF0788579 Ion_trans_2: Ion channel; InterPro: IPR013099 This 99.42
KOG1545|consensus507 99.33
KOG1419|consensus 654 99.23
PF0788579 Ion_trans_2: Ion channel; InterPro: IPR013099 This 99.11
KOG1420|consensus 1103 99.0
KOG4404|consensus350 98.89
PRK10537 393 voltage-gated potassium channel; Provisional 98.79
PLN03192 823 Voltage-dependent potassium channel; Provisional 98.7
KOG4390|consensus 632 98.66
KOG1418|consensus433 98.3
KOG1545|consensus507 98.25
KOG3713|consensus477 98.25
PRK10537 393 voltage-gated potassium channel; Provisional 98.15
KOG0498|consensus 727 98.15
KOG0501|consensus 971 97.92
KOG1419|consensus 654 97.85
KOG3684|consensus489 97.65
PF01007 336 IRK: Inward rectifier potassium channel; InterPro: 97.13
PLN03192 823 Voltage-dependent potassium channel; Provisional 97.06
KOG3193|consensus 1087 96.97
KOG3684|consensus 489 96.78
KOG1420|consensus 1103 96.74
KOG3193|consensus 1087 96.67
KOG4390|consensus 632 96.64
KOG0500|consensus 536 95.19
KOG3827|consensus 400 93.91
KOG0501|consensus 971 91.92
PF00520200 Ion_trans: Ion transport protein calcium channel s 89.9
KOG0499|consensus 815 88.28
KOG0498|consensus 727 87.9
PF01007 336 IRK: Inward rectifier potassium channel; InterPro: 87.75
>KOG4404|consensus Back     alignment and domain information 
Probab=100.00  E-value=4.1e-35  Score=242.61  Aligned_cols=142  Identities=39%  Similarity=0.723  Sum_probs=117.8

Q ss_pred             hhHHHHhhhhhceeeeccccccCCCCCCCCCcccceeeeeeEEEEEEEEeeccccccCCCCceeehhhHHHhhhhHHHHH
Q psy5555          30 LVTEQLRRFESNVIEMSSQLGYNGRDPADKDRQWSFSGALLYSVTVITTIGYGNLAPKTPIGKIVTMVYALFGIPLMLLC  109 (185)
Q Consensus        30 l~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~a~~f~~~t~tTiGyGd~~P~t~~gr~~~~~~~l~Gi~~~~~~  109 (185)
                      +..+.++.++.++.++         +++.....|+|..||||+.+++||||||..+|.|.+||+||++|+++|||+..++
T Consensus        55 ~s~~d~r~~er~i~~s---------~ph~ag~qWkF~GaFYFa~TVItTIGyGhstP~T~~GK~Fcm~Yal~Gipl~lvm  125 (350)
T KOG4404|consen   55 LSEEDYRELERVILKS---------EPHKAGPQWKFAGAFYFATTVITTIGYGHSTPSTDGGKAFCMFYALVGIPLTLVM  125 (350)
T ss_pred             CCHHHHHHHHHHHHhc---------CccccccccccCcceEEEEEEEeeeccCCCCCCCcCceehhhhHHHhcCchHHHH
Confidence            5566777777776655         3345678999999999999999999999999999999999999999999999999


Q ss_pred             Hhhhhhhhhhhhhhhhcccc--cc-cch--------------hheeeehhhhhhhhhcccccccceeEEEEEeeeeeccc
Q psy5555         110 ISNLGSLLADTFQFTYSHSC--CA-SRQ--------------KSGYICIGAGVFAAWEEWSFLDGAYFCFVTLSTIGFGD  172 (185)
Q Consensus       110 ~~~i~~~l~~~~~~~~~~~~--~~-~~~--------------~~~~i~~ga~vf~~~e~w~~~~a~Yf~fiTltTVGfGD  172 (185)
                      ++.+++.+......+.++.+  .. ++.              .++.++.||++|+..|+|+|+||+||||||+|||||||
T Consensus       126 Fqs~gERlnt~~ayil~~~r~~~~~r~~~~S~~~l~~i~~~~~~~~i~~gaa~fs~~E~Wsyfds~YyCFITltTIGFGD  205 (350)
T KOG4404|consen  126 FQSIGERLNTFVAYILRRCRRRLGRRRWDVSVYNLVLILFTACILLICCGAAMFSSVEGWSYFDSYYYCFITLTTIGFGD  205 (350)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhccccCCCcHHHHHHHHHHHHHHHHHhhHHHhhcccCcchhhhhheeeeeeeeccccc
Confidence            99999999887765543211  11 111              33346788999999999999999999999999999999


Q ss_pred             CCCCcccc
Q psy5555         173 LVPGKSFQ  180 (185)
Q Consensus       173 ~vP~~~~~  180 (185)
                      +|+..+-+
T Consensus       206 yValQ~~~  213 (350)
T KOG4404|consen  206 YVALQQDA  213 (350)
T ss_pred             hhhhcchh
Confidence            99987643

>KOG1418|consensus Back     alignment and domain information
>KOG3713|consensus Back     alignment and domain information
>PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] Back     alignment and domain information
>KOG1545|consensus Back     alignment and domain information
>KOG1419|consensus Back     alignment and domain information
>PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] Back     alignment and domain information
>KOG1420|consensus Back     alignment and domain information
>KOG4404|consensus Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG4390|consensus Back     alignment and domain information
>KOG1418|consensus Back     alignment and domain information
>KOG1545|consensus Back     alignment and domain information
>KOG3713|consensus Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>KOG0498|consensus Back     alignment and domain information
>KOG0501|consensus Back     alignment and domain information
>KOG1419|consensus Back     alignment and domain information
>KOG3684|consensus Back     alignment and domain information
>PF01007 IRK: Inward rectifier potassium channel; InterPro: IPR013521 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG3193|consensus Back     alignment and domain information
>KOG3684|consensus Back     alignment and domain information
>KOG1420|consensus Back     alignment and domain information
>KOG3193|consensus Back     alignment and domain information
>KOG4390|consensus Back     alignment and domain information
>KOG0500|consensus Back     alignment and domain information
>KOG3827|consensus Back     alignment and domain information
>KOG0501|consensus Back     alignment and domain information
>PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins Back     alignment and domain information
>KOG0499|consensus Back     alignment and domain information
>KOG0498|consensus Back     alignment and domain information
>PF01007 IRK: Inward rectifier potassium channel; InterPro: IPR013521 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
3ukm_A280 Crystal Structure Of The Human Two Pore Domain Pota 7e-18
3um7_A309 Crystal Structure Of The Human Two Pore Domain K+ I 6e-14
3t1c_A97 Crystal Structure Of Nak Channel D66y Mutant Length 4e-05
3t4d_A97 Crystal Structure Of Nak2k Channel Y55f Mutant Leng 7e-05
3ouf_A97 Structure Of A K+ Selective Nak Mutant Length = 97 1e-04
3t4z_A97 Crystal Structure Of Nak2k Channel Y55w Mutant Leng 2e-04
3tcu_A97 Crystal Structure Of Nak2k Channel D68e Mutant Leng 2e-04
3vou_A148 The Crystal Structure Of Nak-Navsulp Chimera Channe 2e-04
4h33_A137 Crystal Structure Of A Voltage-gated K+ Channel Por 3e-04
3tet_A97 Crystal Structure Of Nak2k Channel Y66f Mutant Leng 3e-04
2q67_A114 Crystal Structure Of Nak Channel D66a Mutant Length 4e-04
2q6a_A114 Crystal Structure Of Nak Channel D66e Mutant Length 5e-04
3e83_A96 Crystal Structure Of The The Open Nak Channel Pore 5e-04
2ahy_A110 Na+ Complex Of The Nak Channel Length = 110 5e-04
2a0l_A241 Crystal Structure Of Kvap-33h1 Fv Complex Length = 5e-04
2q69_A114 Crystal Structure Of Nak Channel D66n Mutant Length 5e-04
1orq_C223 X-Ray Structure Of A Voltage-Dependent Potassium Ch 6e-04
2q68_A114 Crystal Structure Of Nak Channel D66a, S70e Double 7e-04
>pdb|3UKM|A Chain A, Crystal Structure Of The Human Two Pore Domain Potassium Ion Channel K2p1 (Twik-1) Length = 280 Back     alignment and structure 
Iteration: 1

 Score = 86.7 bits (213), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 96/188 (51%), Gaps = 20/188 (10%)
Query: 13  QEDVERLNVLYEQNWTTLVTEQLRRFESNVIEMSSQLGYNGRDPADKDRQWSFSGALLYS 72
           ++++ +L   + +    L  +QL +F   V+E +S  G +    A  +  W F+ AL ++
Sbjct: 43  RQELRKLKRRFLEEHECLSEQQLEQFLGRVLE-ASNYGVSVLSQASGNWNWDFTSALFFA 101
Query: 73  VTVITTIGYGNLAPKTPIGKIVTMVYALFGIPLMLLCISNLGS----------LLADTFQ 122
            TV++T GYG+  P +  GK   ++Y++ GIP  LL ++ +            +L    +
Sbjct: 102 STVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRITVHVTRRPVLYFHIR 161
Query: 123 FTYSHSCCASRQK--------SGYICIGAGVFAAWE-EWSFLDGAYFCFVTLSTIGFGDL 173
           + +S    A            S +  I A VF+  E +W+FL+  YFCF++LSTIG GD 
Sbjct: 162 WGFSKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDY 221
Query: 174 VPGKSFQR 181
           VPG+ + +
Sbjct: 222 VPGEGYNQ 229
>pdb|3UM7|A Chain A, Crystal Structure Of The Human Two Pore Domain K+ Ion Channel Traak (K2p4.1) Length = 309 Back     alignment and structure
>pdb|3T1C|A Chain A, Crystal Structure Of Nak Channel D66y Mutant Length = 97 Back     alignment and structure
>pdb|3T4D|A Chain A, Crystal Structure Of Nak2k Channel Y55f Mutant Length = 97 Back     alignment and structure
>pdb|3OUF|A Chain A, Structure Of A K+ Selective Nak Mutant Length = 97 Back     alignment and structure
>pdb|3T4Z|A Chain A, Crystal Structure Of Nak2k Channel Y55w Mutant Length = 97 Back     alignment and structure
>pdb|3TCU|A Chain A, Crystal Structure Of Nak2k Channel D68e Mutant Length = 97 Back     alignment and structure
>pdb|3VOU|A Chain A, The Crystal Structure Of Nak-Navsulp Chimera Channel Length = 148 Back     alignment and structure
>pdb|4H33|A Chain A, Crystal Structure Of A Voltage-gated K+ Channel Pore Module In A Closed State In Lipid Membranes, Tetragonal Crystal Form Length = 137 Back     alignment and structure
>pdb|3TET|A Chain A, Crystal Structure Of Nak2k Channel Y66f Mutant Length = 97 Back     alignment and structure
>pdb|2Q67|A Chain A, Crystal Structure Of Nak Channel D66a Mutant Length = 114 Back     alignment and structure
>pdb|2Q6A|A Chain A, Crystal Structure Of Nak Channel D66e Mutant Length = 114 Back     alignment and structure
>pdb|3E83|A Chain A, Crystal Structure Of The The Open Nak Channel Pore Length = 96 Back     alignment and structure
>pdb|2AHY|A Chain A, Na+ Complex Of The Nak Channel Length = 110 Back     alignment and structure
>pdb|2A0L|A Chain A, Crystal Structure Of Kvap-33h1 Fv Complex Length = 241 Back     alignment and structure
>pdb|2Q69|A Chain A, Crystal Structure Of Nak Channel D66n Mutant Length = 114 Back     alignment and structure
>pdb|1ORQ|C Chain C, X-Ray Structure Of A Voltage-Dependent Potassium Channel In Complex With An Fab Length = 223 Back     alignment and structure
>pdb|2Q68|A Chain A, Crystal Structure Of Nak Channel D66a, S70e Double Mutants Length = 114 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
3ukm_A280 Potassium channel subfamily K member 1; membrane p 3e-37
3ukm_A280 Potassium channel subfamily K member 1; membrane p 6e-08
3um7_A309 Potassium channel subfamily K member 4; potassium 3e-32
3um7_A309 Potassium channel subfamily K member 4; potassium 8e-06
3ldc_A82 Calcium-gated potassium channel MTHK; transmembran 7e-13
3ldc_A82 Calcium-gated potassium channel MTHK; transmembran 2e-11
2q67_A114 Potassium channel protein; inverted teepee, helix 1e-12
2q67_A114 Potassium channel protein; inverted teepee, helix 3e-11
3ouf_A97 Potassium channel protein; ION channel, membrane, 2e-12
3ouf_A97 Potassium channel protein; ION channel, membrane, 1e-10
3vou_A148 ION transport 2 domain protein, voltage-gated SOD 2e-12
3vou_A148 ION transport 2 domain protein, voltage-gated SOD 6e-11
1lnq_A 336 MTHK channels, potassium channel related protein; 1e-11
1lnq_A 336 MTHK channels, potassium channel related protein; 9e-08
3eff_K139 Voltage-gated potassium channel; FULL length KCSA, 1e-09
3pjs_K166 KCSA, voltage-gated potassium channel; ION channel 2e-09
2k1e_A103 Water soluble analogue of potassium channel, KCSA; 4e-09
2ih3_C122 Voltage-gated potassium channel; ION channel D-ami 1e-08
2a9h_A155 Voltage-gated potassium channel; potassium channel 1e-08
1xl4_A301 Inward rectifier potassium channel; integral membr 4e-08
1p7b_A 333 Integral membrane channel and cytosolic domains; t 6e-08
2qks_A 321 KIR3.1-prokaryotic KIR channel chimera; G-protein 5e-07
2r9r_B514 Paddle chimera voltage gated potassium channel KV; 2e-06
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 2e-06
1orq_C223 Potassium channel; voltage-dependent, KVAP, FAB co 3e-06
3sya_A 340 G protein-activated inward rectifier potassium CH; 5e-04
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Length = 280 Back     alignment and structure
 Score =  129 bits (324), Expect = 3e-37
 Identities = 52/194 (26%), Positives = 91/194 (46%), Gaps = 20/194 (10%)

Query: 11  RKQEDVERLNVLYEQNWTTLVTEQLRRFESNVIEMSSQLGYNGRDPADKDRQWSFSGALL 70
             ++++ +L   + +    L  +QL +F   V+E +S  G +    A  +  W F+ AL 
Sbjct: 41  LLRQELRKLKRRFLEEHECLSEQQLEQFLGRVLE-ASNYGVSVLSQASGNWNWDFTSALF 99

Query: 71  YSVTVITTIGYGNLAPKTPIGKIVTMVYALFGIPLMLLCISNLGSLLADTFQFTYSHSCC 130
           ++ TV++T GYG+  P +  GK   ++Y++ GIP  LL ++ +   +             
Sbjct: 100 FASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRITVHVTRRPVLYFH 159

Query: 131 ASRQKS------------------GYICIGAGVFAAWEE-WSFLDGAYFCFVTLSTIGFG 171
                S                   +  I A VF+  E+ W+FL+  YFCF++LSTIG G
Sbjct: 160 IRWGFSKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLG 219

Query: 172 DLVPGKSFQRTDTQ 185
           D VPG+ + +   +
Sbjct: 220 DYVPGEGYNQKFRE 233
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Length = 280 Back     alignment and structure
>3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Length = 309 Back     alignment and structure
>3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Length = 309 Back     alignment and structure
>3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 3r65_A 3ous_A 3ldd_A Length = 82 Back     alignment and structure
>3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 3r65_A 3ous_A 3ldd_A Length = 82 Back     alignment and structure
>2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Length = 114 Back     alignment and structure
>2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Length = 114 Back     alignment and structure
>3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Length = 97 Back     alignment and structure
>3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Length = 97 Back     alignment and structure
>3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Length = 148 Back     alignment and structure
>3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Length = 148 Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Length = 336 Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Length = 336 Back     alignment and structure
>3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Length = 139 Back     alignment and structure
>3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Length = 166 Back     alignment and structure
>2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Length = 103 Back     alignment and structure
>2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Length = 122 Back     alignment and structure
>2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Length = 155 Back     alignment and structure
>1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* Length = 301 Back     alignment and structure
>1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* Length = 333 Back     alignment and structure
>2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} Length = 321 Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Length = 514 Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Length = 355 Back     alignment and structure
>1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A Length = 223 Back     alignment and structure
>3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* Length = 340 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query185
3ukm_A280 Potassium channel subfamily K member 1; membrane p 99.98
3um7_A309 Potassium channel subfamily K member 4; potassium 99.98
2k1e_A103 Water soluble analogue of potassium channel, KCSA; 99.5
4h33_A137 LMO2059 protein; bilayers, KVLM, lipidic cubic pha 99.46
3eff_K139 Voltage-gated potassium channel; FULL length KCSA, 99.46
3ldc_A82 Calcium-gated potassium channel MTHK; transmembran 99.44
2ih3_C122 Voltage-gated potassium channel; ION channel D-ami 99.44
3pjs_K166 KCSA, voltage-gated potassium channel; ION channel 99.44
3ouf_A97 Potassium channel protein; ION channel, membrane, 99.4
2a9h_A155 Voltage-gated potassium channel; potassium channel 99.37
2q67_A114 Potassium channel protein; inverted teepee, helix 99.37
3ldc_A82 Calcium-gated potassium channel MTHK; transmembran 99.36
3ouf_A97 Potassium channel protein; ION channel, membrane, 99.3
3vou_A148 ION transport 2 domain protein, voltage-gated SOD 99.29
2q67_A114 Potassium channel protein; inverted teepee, helix 99.29
1orq_C223 Potassium channel; voltage-dependent, KVAP, FAB co 99.24
3vou_A148 ION transport 2 domain protein, voltage-gated SOD 99.22
2k1e_A103 Water soluble analogue of potassium channel, KCSA; 99.22
3eff_K139 Voltage-gated potassium channel; FULL length KCSA, 99.18
3pjs_K166 KCSA, voltage-gated potassium channel; ION channel 99.14
4h33_A137 LMO2059 protein; bilayers, KVLM, lipidic cubic pha 99.11
2ih3_C122 Voltage-gated potassium channel; ION channel D-ami 99.09
3um7_A309 Potassium channel subfamily K member 4; potassium 99.08
2a9h_A155 Voltage-gated potassium channel; potassium channel 99.06
1lnq_A 336 MTHK channels, potassium channel related protein; 99.03
3ukm_A280 Potassium channel subfamily K member 1; membrane p 99.01
1xl4_A301 Inward rectifier potassium channel; integral membr 98.98
2qks_A 321 KIR3.1-prokaryotic KIR channel chimera; G-protein 98.98
1p7b_A 333 Integral membrane channel and cytosolic domains; t 98.94
1lnq_A 336 MTHK channels, potassium channel related protein; 98.92
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 98.85
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 98.84
2r9r_B514 Paddle chimera voltage gated potassium channel KV; 98.78
1orq_C223 Potassium channel; voltage-dependent, KVAP, FAB co 98.69
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 98.52
3sya_A 340 G protein-activated inward rectifier potassium CH; 98.51
3beh_A 355 MLL3241 protein; transmembrane protein, membrane p 98.36
3spc_A 343 Inward-rectifier K+ channel KIR2.2; PIP, membrane 98.33
1xl4_A 301 Inward rectifier potassium channel; integral membr 98.31
1p7b_A 333 Integral membrane channel and cytosolic domains; t 98.16
2qks_A 321 KIR3.1-prokaryotic KIR channel chimera; G-protein 98.13
2r9r_B 514 Paddle chimera voltage gated potassium channel KV; 97.65
3sya_A 340 G protein-activated inward rectifier potassium CH; 97.37
3rvy_A285 ION transport protein; tetrameric ION channel, vol 97.17
3spc_A 343 Inward-rectifier K+ channel KIR2.2; PIP, membrane 97.16
3rvy_A285 ION transport protein; tetrameric ION channel, vol 90.86
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Back     alignment and structure
Probab=99.98  E-value=6.5e-36  Score=247.41  Aligned_cols=162  Identities=33%  Similarity=0.626  Sum_probs=126.7

Q ss_pred             hhhhhhhhccchhhhHHHHhhhhhceeeeccccccCCCCCCCCCcccceeeeeeEEEEEEEEeeccccccCCCCceeehh
Q psy5555          17 ERLNVLYEQNWTTLVTEQLRRFESNVIEMSSQLGYNGRDPADKDRQWSFSGALLYSVTVITTIGYGNLAPKTPIGKIVTM   96 (185)
Q Consensus        17 ~~~~~~~~~~~~~l~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~a~~f~~~t~tTiGyGd~~P~t~~gr~~~~   96 (185)
                      +|.+.+  ++..|+..++|+++.+.+.++ ...|..+.++..+.+.|++.+|+||+++|+|||||||++|.|+.||++++
T Consensus        49 ~~~~fl--~~~~~~s~~~l~~~~~~~~~a-~~~g~~~~~~~~~~~~w~~~~a~yf~~~t~tTvGyGd~~P~T~~Gk~f~~  125 (280)
T 3ukm_A           49 LKRRFL--EEHECLSEQQLEQFLGRVLEA-SNYGVSVLSQASGNWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCI  125 (280)
T ss_dssp             HHHHHH--HHCTTCCHHHHHHHHHHHHHH-HTTTCCCC------CCSSHHHHHHHHHHHHTTCCCCSSCCCSHHHHHHHH
T ss_pred             HHHHHH--HhcccccHHHHHHHHHHHHHH-HhcCCccccCCCCCCCCChhcchhheeeeeeccccCCcCCCCchhHHHHH
Confidence            344444  344567778899999888887 77888877766778899999999999999999999999999999999999


Q ss_pred             hHHHhhhhHHHHHHhhhhhhhhhhhhhh-hc---ccccccc--------------hhheeeehhhhhhhhhc-ccccccc
Q psy5555          97 VYALFGIPLMLLCISNLGSLLADTFQFT-YS---HSCCASR--------------QKSGYICIGAGVFAAWE-EWSFLDG  157 (185)
Q Consensus        97 ~~~l~Gi~~~~~~~~~i~~~l~~~~~~~-~~---~~~~~~~--------------~~~~~i~~ga~vf~~~e-~w~~~~a  157 (185)
                      +|+++|+|++++.++.+++.+.....+. ..   ++...++              .+++++++|+++|+..| +|+|.||
T Consensus       126 ~~~l~Gi~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~ga~~~~~~E~~~s~~da  205 (280)
T 3ukm_A          126 IYSVIGIPFTLLFLTAVVQRITVHVTRRPVLYFHIRWGFSKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLES  205 (280)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHSSTTTTTC------CCHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHSSSCCHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCChhHHHHHHHHHHHHHHHHHHHhHHHHHHHHHhcCCchhhh
Confidence            9999999999999999998876654221 11   1111110              03446678899999999 8999999


Q ss_pred             eeEEEEEeeeeecccCCCCccccc
Q psy5555         158 AYFCFVTLSTIGFGDLVPGKSFQR  181 (185)
Q Consensus       158 ~Yf~fiTltTVGfGD~vP~~~~~~  181 (185)
                      +|||++|+|||||||++|.++.+|
T Consensus       206 ~y~~~iTltTvGyGD~~p~t~~~~  229 (280)
T 3ukm_A          206 FYFCFISLSTIGLGDYVPGEGYNQ  229 (280)
T ss_dssp             HHHHHHHHTTCCCCSCCSSCSSSC
T ss_pred             hhheeeeeecccCCCCCCCCCccc
Confidence            999999999999999999999764
>3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Back     alignment and structure
>2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Back     alignment and structure
>4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A Back     alignment and structure
>3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Back     alignment and structure
>3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A Back     alignment and structure
>2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Back     alignment and structure
>3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Back     alignment and structure
>3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Back     alignment and structure
>2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Back     alignment and structure
>2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Back     alignment and structure
>3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A Back     alignment and structure
>3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Back     alignment and structure
>3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Back     alignment and structure
>2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Back     alignment and structure
>1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A Back     alignment and structure
>3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Back     alignment and structure
>2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Back     alignment and structure
>3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Back     alignment and structure
>3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Back     alignment and structure
>4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A Back     alignment and structure
>2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Back     alignment and structure
>3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Back     alignment and structure
>2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Back     alignment and structure
>1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* Back     alignment and structure
>2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Back     alignment and structure
>1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* Back     alignment and structure
>1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* Back     alignment and structure
>1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* Back     alignment and structure
>2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Back     alignment and structure
>3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* Back     alignment and structure
>3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* Back     alignment and structure
>3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* Back     alignment and structure
>3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 185
d1lnqa280 f.14.1.1 (A:19-98) Potassium channel-related prote 2e-13
d1lnqa280 f.14.1.1 (A:19-98) Potassium channel-related prote 4e-10
d1xl4a2116 f.14.1.1 (A:23-138) Inward rectifier potassium cha 3e-07
d1r3jc_103 f.14.1.1 (C:) Potassium channel protein {Streptomy 6e-07
d1p7ba2116 f.14.1.1 (A:36-151) Inward rectifier potassium cha 8e-07
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Voltage-gated potassium channels
superfamily: Voltage-gated potassium channels
family: Voltage-gated potassium channels
domain: Potassium channel-related protein MthK
species: Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]

 Score = 60.5 bits (147), Expect = 2e-13
 Identities = 16/55 (29%), Positives = 29/55 (52%)

Query: 63  WSFSGALLYSVTVITTIGYGNLAPKTPIGKIVTMVYALFGIPLMLLCISNLGSLL 117
            S++ +L ++   I T+GYG+ +P TP+G   T+   + GI    + +  L   L
Sbjct: 26  ESWTVSLYWTFVTIATVGYGDYSPSTPLGMYFTVTLIVLGIGTFAVAVERLLEFL 80
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 Back     information, alignment and structure
>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Length = 116 Back     information, alignment and structure
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Length = 103 Back     information, alignment and structure
>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Length = 116 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query185
d1r3jc_103 Potassium channel protein {Streptomyces coelicolor 99.49
d1lnqa280 Potassium channel-related protein MthK {Archaeon M 99.45
d1lnqa280 Potassium channel-related protein MthK {Archaeon M 99.4
d1p7ba2116 Inward rectifier potassium channel Kirbac1.1 {Burk 99.31
d1xl4a2116 Inward rectifier potassium channel kirbac3.1 {Magn 99.27
d1r3jc_103 Potassium channel protein {Streptomyces coelicolor 99.0
d1p7ba2116 Inward rectifier potassium channel Kirbac1.1 {Burk 98.65
d1xl4a2116 Inward rectifier potassium channel kirbac3.1 {Magn 98.59
d2h8pc157 Potassium channel protein {Streptomyces coelicolor 96.93
d2h8pc157 Potassium channel protein {Streptomyces coelicolor 96.79
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Voltage-gated potassium channels
superfamily: Voltage-gated potassium channels
family: Voltage-gated potassium channels
domain: Potassium channel protein
species: Streptomyces coelicolor [TaxId: 1902]

Probab=99.49  E-value=1.8e-16  Score=111.10  Aligned_cols=64  Identities=31%  Similarity=0.447  Sum_probs=57.8

Q ss_pred             CCcccceeeeeeEEEEEEEEeeccccccCCCCceeehhhHHHhhhhHHHHHHhhhhhhhhhhhh
Q psy5555          59 KDRQWSFSGALLYSVTVITTIGYGNLAPKTPIGKIVTMVYALFGIPLMLLCISNLGSLLADTFQ  122 (185)
Q Consensus        59 ~~~~w~~~~a~~f~~~t~tTiGyGd~~P~t~~gr~~~~~~~l~Gi~~~~~~~~~i~~~l~~~~~  122 (185)
                      +.+..++.||+||+++|+|||||||+.|.|+.||+++++++++|+.++++.++.+++.+.+..+
T Consensus        35 ~~~~~s~~~aly~~~vT~tTvGYGDi~P~t~~gr~~~~~~~~~Gi~~~~~~~~~i~~~~~~~~~   98 (103)
T d1r3jc_          35 GAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQ   98 (103)
T ss_dssp             TCCCCSHHHHHHHHHHHHTTCCCSSSCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CcccCchhhhhhhheeeecccccCccccCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3456689999999999999999999999999999999999999999999999999988776543
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Back     information, alignment and structure
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Back     information, alignment and structure
>d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure