Diaphorina citri psyllid: psy5556


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
MSGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRSCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTRGLVAFTGPTQAG
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
******LRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRSCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTRG***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRSCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTGGLGLRNCNTRGLVAFTGPTQAG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0019732 [BP]antifungal humoral responseprobableGO:0006952, GO:0009607, GO:0019730, GO:0009620, GO:0050896, GO:0050832, GO:0002376, GO:0006950, GO:0008150, GO:0006955, GO:0006959, GO:0051707, GO:0051704
GO:0016020 [CC]membraneprobableGO:0005575
GO:0019731 [BP]antibacterial humoral responseprobableGO:0002376, GO:0009607, GO:0019730, GO:0050896, GO:0009617, GO:0006952, GO:0006950, GO:0008150, GO:0042742, GO:0006955, GO:0006959, GO:0051707, GO:0051704
GO:0043229 [CC]intracellular organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0043226
GO:0003674 [MF]molecular_functionprobable
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0052553 [BP]modulation by symbiont of host immune responseprobableGO:0052552, GO:0050896, GO:0048583, GO:0052572, GO:0065007, GO:0052200, GO:0050789, GO:0031347, GO:0075136, GO:0052031, GO:0044419, GO:0051817, GO:0002682, GO:0065008, GO:0052564, GO:0008150, GO:0052255, GO:0051701, GO:0051707, GO:0044003, GO:0051704, GO:0052173, GO:0050776, GO:0009607, GO:0080134, GO:0044403, GO:0035821
GO:0032991 [CC]macromolecular complexprobableGO:0005575
GO:0005576 [CC]extracellular regionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2W7Z, chain A
Confidence level:probable
Coverage over the Query: 7-104
View the alignment between query and template
View the model in PyMOL