Diaphorina citri psyllid: psy5567

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310----

AWLGLPIGQHLSLSATINDEFVARAYTPVTSDEHHGYMDLVVKSVPSILVGVGLIVVVGFIISAIQESKSKKKDKASRSSKKELKTLVDPDVKVPLKLKEKIEINHDTRCFRFELPSAEHVLGKQVIGFDARHRQKKKNPIANILTPFQRVSFWCSRVVSAPESEPPFHFAWLGLPIGQHLSLSATINDEFVARAYTPVTSDEHHGYMDLVVKVYFKNVHPKFPDGGKMSQFLENMKVGEPINVSGPRGRLAYLGNGEFHIRAVSKKDPPTNLKVTQLSMIAGGTGITPMLQLVRHITKDPTDNTKMSLIFANQ

cccccccccEEEEEEEEccEEEEEcccccccccccccEEEEEEccccEEEEEEEEEEHHHHHHHHHHcccccccccccccccccccccccccEEEEEEEEEEECccccEEEEECcccccccccccccccHHHccccccccccccccccEEEEEEEEEEEEcccccccccccccccccccEEEEEEEEccEEEEEEECcccccccccCEEEEEEEEEccccccccccccHHHHHcccccccEEEEccccccEEEccccEEEEcccccccccccccccEEEEEEEcccHHHHHHHHHHHHcccccccEEEEEEEcc

AWLGLPIGQHLSLSATINDEFVARAYTPVTSDEHHGYMDLVVKSVPSILVGVGLIVVVGFIISAIQ************************DVKVPLKLKEKIEINHDTRCFRFELPSAEHVLGKQVIGFDARHRQKKKNPIANILTPFQRVSFWCSRVVSAPESEPPFHFAWLGLPIGQHLSLSATINDEFVARAYTPVTSDEHHGYMDLVVKVYFKNVHPKFPDGGKMSQFLENMKVGEPINVSGPRGRLAYLGNGEFHIRAVSKKDPPTNLKVTQLSMIAGGTGITPMLQLVRHITKDPTDNTKMSLIFANQ

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
NADH-cytochrome b5 reductase 1	Electron donor reductase for cytochrome b5. The cytochrome b5/NADH cytochrome b5 reductase electron transfer system supports the catalytic activity of several sterol biosynthetic enzymes.	confident	Q54NC1
NADH-cytochrome b5 reductase 2	NADH-cytochrome b5 reductases are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis and drug metabolism.	confident	Q5BJ68
NADH-cytochrome b5 reductase 2	NADH-cytochrome b5 reductases are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis and drug metabolism.	confident	Q0P487

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0010883 [BP]	regulation of lipid storage	probable	GO:0008150, GO:0032879, GO:0065007, GO:0050789
GO:0071949 [MF]	FAD binding	probable	GO:0043168, GO:0050662, GO:0050660, GO:0097159, GO:0043167, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:0000166, GO:1901363, GO:1901265
GO:0043531 [MF]	ADP binding	probable	GO:0043168, GO:0017076, GO:0030554, GO:0097159, GO:0003674, GO:1901363, GO:1901265, GO:0043167, GO:0036094, GO:0032559, GO:0032553, GO:0032549, GO:0032555, GO:0005488, GO:0000166, GO:0032550, GO:0001883, GO:0001882
GO:0016208 [MF]	AMP binding	probable	GO:0043168, GO:0043169, GO:0017076, GO:0030554, GO:0097159, GO:0003674, GO:1901363, GO:1901265, GO:0043167, GO:0036094, GO:0032559, GO:0032553, GO:0032549, GO:0032555, GO:0005488, GO:0000166, GO:0032550, GO:0001883, GO:0001882
GO:0044699 [BP]	single-organism process	probable	GO:0008150
GO:0005811 [CC]	lipid particle	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005789 [CC]	endoplasmic reticulum membrane	probable	GO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0055114 [BP]	oxidation-reduction process	probable	GO:0044710, GO:0008150, GO:0008152
GO:0004128 [MF]	cytochrome-b5 reductase activity, acting on NAD(P)H	probable	GO:0003824, GO:0016491, GO:0003674, GO:0016651, GO:0016653
GO:0006810 [BP]	transport	probable	GO:0051234, GO:0008150, GO:0051179
GO:0009987 [BP]	cellular process	probable	GO:0008150
GO:0005743 [CC]	mitochondrial inner membrane	probable	GO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0051287 [MF]	NAD binding	probable	GO:0050662, GO:0097159, GO:0000166, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:1901363, GO:1901265

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
1.-.-.-	Oxidoreductases.	probable
1.6.-.-	Acting on NADH or NADPH.	probable
1.6.2.-	With a heme protein as acceptor.	probable
1.6.2.2	Cytochrome-b5 reductase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UMK, chain A
Confidence level:very confident
Coverage over the Query: 82-122,174-314
View the alignment between query and template
View the model in PyMOL

Template: 2EIX, chain A
Confidence level:very confident
Coverage over the Query: 3-49
View the alignment between query and template
View the model in PyMOL