Diaphorina citri psyllid: psy5601

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270

MTFTKTSQKFGQWSDIRANTVSLVQAQLDTLLASQDAQRRIIDTLNHQLAGRVADSANAKKWEIELANLKSNNLRLTSALQESTANVEEWKKQLQAYKEENQKLKTKYIELEATKGVSEAAVELRKELTSVRSKNETLDSELKCRDEEVKKLTNAKHAVEDKCKAAVELRKELTSVRSKNETLDSELKCRDEEVKKLTNAKHAVEDKCKLLSQENAELQAAISLVQAQLDTLLASQDAQRRIIDTLNHQLAGRVAELATIHREINTALQT

ccccccccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc

*TFTKTSQKFGQWSDIRANTVSLVQAQLDTLLASQDAQRRIIDTLNHQLAGRVADSANAKKWEIELANLKSNNLR********************************YIE*************************************************************************************************CKLLS*ENAELQAAISLVQAQLDTLLASQDAQRRIIDTLNHQLAGRVAELATIHREI******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MTFTKTSQKFGQWSDIRANTVSLVQAQLDTLLASQDAQRRIIDTLNHQLAGRVADSANxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKGVSEAxxxxxxxxxxxxxxxxxxxxxLKCRDEEVKKLTNAKHAVEDKCKAxxxxxxxxxxxxxxxxxxxxxLKCRDEExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLDTLLASQDAQRRIIDTLNHQLAGRVAELATIHREINTALQT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0015629 [CC]	actin cytoskeleton	probable	GO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0050896 [BP]	response to stimulus	probable	GO:0008150
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0044446 [CC]	intracellular organelle part	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0030425 [CC]	dendrite	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DFS, chain A
Confidence level:confident
Coverage over the Query: 129-197
View the alignment between query and template
View the model in PyMOL

Template: 3CVF, chain A
Confidence level:confident
Coverage over the Query: 203-269
View the alignment between query and template
View the model in PyMOL

Template: 1I2H, chain A
Confidence level:confident
Coverage over the Query: 1-55
View the alignment between query and template
View the model in PyMOL

Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 95-151
View the alignment between query and template
View the model in PyMOL