Diaphorina citri psyllid: psy5620


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--
MTIFALGRTCYKHPEFRGPFLGPKPSEENKRFFTEDQLRAGEGMIGLQAGTNKLASQSGQNFGATRKIILGK
ccHHHHHHHHHcccccccccccccccccccccccHHHHHccccEEEEccccccccccccccccccCEEEccc
MTIFALGRTCYKHPEFRGPFLGPKPSE****************MIGLQAGTNKLASQS*QNFGATRKII***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTIFALGRTCYKHPEFRGPFLGPKPSEENKRFFTEDQLRAGEGMIGLQAGTNKLASQSGQNFGATRKIILGK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Muscle-specific protein 20 confidentP14318

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0070594 [MF]juvenile hormone response element bindingprobableGO:0044212, GO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0005856 [CC]cytoskeletonprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2RR8, chain A
Confidence level:very confident
Coverage over the Query: 1-55
View the alignment between query and template
View the model in PyMOL