Diaphorina citri psyllid: psy5629


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200---
MIINLNESHREHLSVLFQLPPEVIQDFCTLTTNYLKDGPNQKLYKSVSKKLSLPSADNVQDSVEGLVYFLLLATILNISEYDFCNTLYHMGFTQDDKCEKILYEFYTQEKYNLYRTLISEYISVVATRSHLNQCEPKFTIRLHLENPDEQEKQIDLEMDVRSVLNITQILEEALSHAKLNQRKMSRRKQLSQTKSKVLSDSQK
ccccccHHHHHHccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccccccEEcccccccccccEEEEEEEEccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc
*I*N***SHREHLSVLFQLPPEVIQDFCTLTTNYLKDGPNQKLYKSVSKKLSLPSADNVQDSVEGLVYFLLLATILNISEYDFCNTLYHMGFTQDDKCEKILYEFYTQEKYNLYRTLISEYISVVATRSHLNQCEPKFTIRLHL**********DLEMDVRSVLNITQILEEALSHAKLN*RKMSRRKQLSQTK**V******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIINLNESHREHLSVLFQLPPEVIQDFCTLTTNYLKDGPNQKLYKSVSKKLSLPSADNVQDSVEGLVYFLLLATILNISEYDFCNTLYHMGFTQDDKCEKILYEFYTQEKYNLYRTLISEYISVVATRSHLNQCEPKFTIRLHLENPDEQEKQIDLEMDVRSVLNITQILEEALSHAKLNQRKMSRRKQLSQTKSKVLSDSQK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
COMM domain-containing protein 2 May down-regulate activation of NF-kappa-B.confidentQ86X83
COMM domain-containing protein 2 May down-regulate activation of NF-kappa-B.confidentQ8BXC6
COMM domain-containing protein 2 May down-regulate activation of NF-kappa-B.confidentQ5R610

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UG2, chain A
Confidence level:probable
Coverage over the Query: 33-74
View the alignment between query and template
View the model in PyMOL