Diaphorina citri psyllid: psy5641

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--

MVQKVSLLGLHNNKSNNMCSTYDHSMSCRRQAYGLVSLSSNDIRVLPPKPLLFANGDKVPGVIGLRNHGNTCFINAILQCLSHTDILAEYFVLDQYKIDMSRRNKFNSKKYGTKGEVTEQLAVLLKSIWSCSYNPDISNQFKVIIDKYGTQYRGNNQHDAQEFLMWLLDKVHEDLNTATKKKYKTIKVKTPK

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccHHHHHHHccccHHHHHccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccc

******************CST**************************************PGVIGLRNHGNTCFINAILQCLSHTDILAEYFVLDQYKIDMSRRNKFNSKKYGTKGEVTEQLAVLLKSIWSCSYNPDISNQFKVIIDKYGTQYRGNNQHDAQEFLMWLLDKVHEDLNTATK************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVQKVSLLGLHNNKSNNMCSTYDHSMSCRRQAYGLVSLSSNDIRVLPPKPLLFANGDKVPGVIGLRNHGNTCFINAILQCLSHTDILAEYFVLDQYKIDMSRRNKFNSKKYGTKGEVTEQLAVLLKSIWSCSYNPDISNQFKVIIDKYGTQYRGNNQHDAQEFLMWLLDKVHEDLNTATKKKYKTIKVKTPK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044425 [CC]	membrane part	probable	GO:0005575, GO:0016020
GO:0004843 [MF]	ubiquitin-specific protease activity	probable	GO:0016787, GO:0019783, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008234
GO:0031647 [BP]	regulation of protein stability	probable	GO:0019222, GO:0060255, GO:0010608, GO:0050789, GO:0065007, GO:0008150, GO:0065008, GO:0010468
GO:0071944 [CC]	cell periphery	probable	GO:0005575, GO:0044464, GO:0005623
GO:0044763 [BP]	single-organism cellular process	probable	GO:0009987, GO:0008150, GO:0044699
GO:0005768 [CC]	endosome	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0070536 [BP]	protein K63-linked deubiquitination	probable	GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0070646, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0016579
GO:0004221 [MF]	ubiquitin thiolesterase activity	probable	GO:0016787, GO:0003674, GO:0016790, GO:0016788, GO:0003824
GO:0050794 [BP]	regulation of cellular process	probable	GO:0008150, GO:0065007, GO:0050789
GO:0071108 [BP]	protein K48-linked deubiquitination	probable	GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0070646, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0016579
GO:0044446 [CC]	intracellular organelle part	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0016043 [BP]	cellular component organization	probable	GO:0008150, GO:0071840

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Y6E, chain A
Confidence level:very confident
Coverage over the Query: 73-184
View the alignment between query and template
View the model in PyMOL

Template: 3IHP, chain A
Confidence level:very confident
Coverage over the Query: 24-45,56-176
View the alignment between query and template
View the model in PyMOL