Diaphorina citri psyllid: psy5645

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-----

MFTSYDHWENLIRQILAKPFKVPILNYTGSGYSTKALGVRREGARKALHDPTAPNALVLYTPPQLSAHDLLKIDKDKIQVHVVVDPVLSNIYLTWKTNHQYEIRLPLFRPKHKYIRITKKDSFKPEEHVLSNVLEKAEKACLYDLDDCDIAWLNILNGERACMGIMYNTQDDEEATSSPMDSVHSSRGGSSYSDLKSMNSIYNRNTNEAPAELFRKDLISAMKLPDSEPLKSDEFWVISDQWKQEWERGVQVPVNPDSLPGPQVTVVSTLNSTRYPNNYNEPFKLGNNKHLFPIPPGLPAIQEDRLEKMIAELEVRCWDKVQTIIKEEEGLGLEFDENVICDVCRSPDSEEGNEMVFCDCCNICVHQACYGITTIPSGSWLCRTCVLGKRPECILCPNKGGAMKCARSGNKWAHVSCALWIPEVSIGCVEKMEPITKISSIPQSRWALICILCRERLGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDENAEDGVKLRSYCQKHSLTTKKTEKTVATVPSSGE

ccccHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHcccccccccEEEEcccccccHHHHHcccccccccccccccccccEEEECcccccccccccccccccEEEEcccccccccccccccHHHHHHHccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccEEEcccHHHHHHcccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEcccccccccccEEEccccccccccccccccccccccccccccccccccccEEccccccccccccccccEEEEEEccccccEEEccccccccccccccccccccccccEEccccccEEEEcccccccccccHHHHHHccccEEEEEcccccccccEEEEcccccccccccccccccccccccc

****YDHWENLIRQILAKPFKVPILNYTGSGYSTKALGVRREGARKALHDPTAPNALVLYTPPQLSAHDLLKIDKDKIQVHVVVDPVLSNIYLTWKTNHQYEIRLPLFRPKHKYIRITKKDSFKPEEHVLSNVLEKAEKACLYDLDDCDIAWLNILNGERACMGI************************************************FRKDLISAMKLPDSEPLKSDEFWVISDQWKQEWERGVQVPVNPDSLPGPQVTVVSTLNSTRYPNNYNEPFKLGNNKHLFPIPPGLPAIQEDRLEKMIAELEVRCWDKVQTIIKEEEGLGLEFDENVICDVCRSPDSEEGNEMVFCDCCNICVHQACYGITTIPSGSWLCRTCVLGKRPECILCPNKGGAMKCARSGNKWAHVSCALWIPEVSIGCVEKMEPITKISSIPQSRWALICILCRERLGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDENAEDGVKLRSYCQK********************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein Jade-1	Component of the HBO1 complex which has a histone H4-specific acetyltransferase activity, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. Transcriptional coactivator it may also promote acetylation of nucleosomal histone H4 by KAT5. Promotes apoptosis. May act as a renal tumor suppressor.	confident	Q6IE81
Protein Jade-1	Component of the HBO1 complex which has a histone H4-specific acetyltransferase activity, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. Transcriptional coactivator it may also promote acetylation of nucleosomal histone H4 by KAT5. Promotes apoptosis. May act as a renal tumor suppressor.	confident	Q5E9T7
PHD finger protein rhinoceros	May function as a negative regulator of the EGFR/Ras/MAPK signaling pathway during eye development.	confident	Q7YZH1

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0000123 [CC]	histone acetyltransferase complex	probable	GO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0043981 [BP]	histone H4-K5 acetylation	probable	GO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018394, GO:0018193, GO:0071704, GO:0016570, GO:0016573, GO:0018393, GO:0043967, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0044763, GO:0016568, GO:0016569
GO:0043966 [BP]	histone H3 acetylation	probable	GO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018193, GO:0071704, GO:0016570, GO:0016573, GO:0018393, GO:0018394, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0008150, GO:0016568, GO:0016569
GO:0043982 [BP]	histone H4-K8 acetylation	probable	GO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018394, GO:0018193, GO:0071704, GO:0016570, GO:0016573, GO:0018393, GO:0043967, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0044763, GO:0016568, GO:0016569
GO:0043983 [BP]	histone H4-K12 acetylation	probable	GO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018394, GO:0018193, GO:0071704, GO:0016570, GO:0016573, GO:0018393, GO:0043967, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0044763, GO:0016568, GO:0016569
GO:0043984 [BP]	histone H4-K16 acetylation	probable	GO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018394, GO:0018193, GO:0071704, GO:0016570, GO:0016573, GO:0018393, GO:0043967, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0044763, GO:0016568, GO:0016569

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L43, chain A
Confidence level:very confident
Coverage over the Query: 333-388
View the alignment between query and template
View the model in PyMOL

Template: 2LQ6, chain A
Confidence level:confident
Coverage over the Query: 439-510
View the alignment between query and template
View the model in PyMOL

Template: 1Z3I, chain X
Confidence level:confident
Coverage over the Query: 37-103
View the alignment between query and template
View the model in PyMOL

Template: 4GNE, chain A
Confidence level:probable
Coverage over the Query: 392-419,438-509
View the alignment between query and template
View the model in PyMOL

Template: 2ZET, chain C
Confidence level:probable
Coverage over the Query: 296-388
View the alignment between query and template
View the model in PyMOL