Psyllid ID: psy5645

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-----

MFTSYDHWENLIRQILAKPFKVPILNYTGSGYSTKALGVRREGARKALHDPTAPNALVLYTPPQLSAHDLLKIDKDKIQVHVVVDPVLSNIYLTWKTNHQYEIRLPLFRPKHKYIRITKKDSFKPEEHVLSNVLEKAEKACLYDLDDCDIAWLNILNGERACMGIMYNTQDDEEATSSPMDSVHSSRGGSSYSDLKSMNSIYNRNTNEAPAELFRKDLISAMKLPDSEPLKSDEFWVISDQWKQEWERGVQVPVNPDSLPGPQVTVVSTLNSTRYPNNYNEPFKLGNNKHLFPIPPGLPAIQEDRLEKMIAELEVRCWDKVQTIIKEEEGLGLEFDENVICDVCRSPDSEEGNEMVFCDCCNICVHQACYGITTIPSGSWLCRTCVLGKRPECILCPNKGGAMKCARSGNKWAHVSCALWIPEVSIGCVEKMEPITKISSIPQSRWALICILCRERLGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDENAEDGVKLRSYCQKHSLTTKKTEKTVATVPSSGE

ccccHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHccccccccEEEEcccccccHHHHHHccccccccccccccccccEEEEEcccccccccccccccccEEEEcccccccccccccccHHHHHHHccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccEEEcccHHHHHHcccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEcccccccccccEEEccccccccccccccccccccccccccccccccccccEEccccccccccccccccEEEEEEccccccEEEccccccccccccccccccccccccEEccccccEEEEcccccccccccHHHHHHccccEEEEEcccccccccEEEEcccccccccccccccccccccccc

cccccHHHHHHHHHHHccccccEEEEcccccccHHHHccccccccccccccccccEEEEEcccHHHHHHccccccccccEEEEccccccccccccccccccEEEcccccccccEEEEEccccccccHcccccHHHHHHHHHcccccHHHHHHHHHHcHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccEEEEcccHHHHHHcccccccccccccccEEEEEcccccEEccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccccccEEEcccEEEEEEcccccccccEEEEEccccEEEEHHcccccccccccEEEHHcccccccccEEcccccccccEcccccEEEEEEEEEEccEEEEccccEEccccccccccHHHHHHHHHHHHHccccEEEEcccccEEEEEHHHHHHcccEEEEEEccccccccEEEEEEccccccccccccccccccccccc

MFTSYDHWENLIRQILAkpfkvpilnytgsgystkalGVRREgarkalhdptapnalvlytppqlsahdllkidkdkiqvHVVVDPVLSNIYLtwktnhqyeirlplfrpkhkyiritkkdsfkpeeHVLSNVLEKAEKAclydlddcdiaWLNILNGERACMGImyntqddeeatsspmdsvhssrggssysdlksmnsiynrntneapAELFRKDLIsamklpdseplksdefWVISDQWKQEwergvqvpvnpdslpgpqvtVVSTlnstrypnnynepfklgnnkhlfpippglpaiQEDRLEKMIAELEVRCWDKVQTIIKEeeglglefdenvicdvcrspdseegnemvfcdccnicvhqacygittipsgswlcrtcvlgkrpecilcpnkggamkcarsgnkwahvscalwipevsigcvekmepitkissipQSRWALICILCRERLGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIedenaedgvKLRSYCqkhslttkktektvatvpssge

MFTSYDHWENLIRQILAKPFKVPILNYTGSGYSTKALGVRREGARKAlhdptapnalvlYTPPQLSAHDLLKIDKDKIQVHVVVDPVLSNIYLTwktnhqyeirlplfrpkhKYIRitkkdsfkpeEHVLSNVLEKAEKACLYDLDDCDIAWLNILNGERACMGIMYNTQDDEeatsspmdsvhssrggssysdlkSMNSIYNRNTNEAPAELFRKDLISAMKlpdseplksDEFWVISDQWKQEWERGVQVpvnpdslpgpqVTVVSTLNSTRYPNNYNEPFKLGNNKHLFPIPPGLPAIQEDRLEKMIAELEVRCWDKVQTIIKEeeglglefdenvICDVCRSPDSEEGNEMVFCDCCNICVHQACYGITTIPSGSWLCRTCVLGKRPECILCPNKGGAMKCARSGNKWAHVSCALWIPEVSIGCVEKMEPitkissipqsRWALICILCRERLGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDENAEDGVKLRSYcqkhslttkktektvatvpssge

MFTSYDHWENLIRQILAKPFKVPILNYTGSGYSTKALGVRREGARKALHDPTAPNALVLYTPPQLSAHDLLKIDKDKIQVHVVVDPVLSNIYLTWKTNHQYEIRLPLFRPKHKYIRITKKDSFKPEEHVLSNVLEKAEKACLYDLDDCDIAWLNILNGERACMGIMYNTQDDEEATSSPMDsvhssrggssysdlksMNSIYNRNTNEAPAELFRKDLISAMKLPDSEPLKSDEFWVISDQWKQEWERGVQVPVNPDSLPGPQVTVVSTLNSTRYPNNYNEPFKLGNNKHLFPIPPGLPAIQEDRLEKMIAELEVRCWDKVQTIIKEEEGLGLEFDENVICDVCRSPDSEEGNEMVFCDCCNICVHQACYGITTIPSGSWLCRTCVLGKRPECILCPNKGGAMKCARSGNKWAHVSCALWIPEVSIGCVEKMEPITKISSIPQSRWALICILCRERLGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDENAEDGVKLRSYCQKHSLttkktektVATVPSSGE

****YDHWENLIRQILAKPFKVPILNYTGSGYSTKALGVRREGARKALHDPTAPNALVLYTPPQLSAHDLLKIDKDKIQVHVVVDPVLSNIYLTWKTNHQYEIRLPLFRPKHKYIRITKKDSFKPEEHVLSNVLEKAEKACLYDLDDCDIAWLNILNGERACMGIMYN****************************************************************DEFWVISDQWKQEWERGVQVPVN*******QVTVVSTLNSTRYPNNYNEPFKLGNNKHLFPIPPGLPAIQEDRLEKMIAELEVRCWDKVQTIIKEEEGLGLEFDENVICDVCRSPD**EGNEMVFCDCCNICVHQACYGITTIPSGSWLCRTCVLGKRPECILCPNKGGAMKCARSGNKWAHVSCALWIPEVSIGCVEKMEPITKISSIPQSRWALICILCRERLGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDENAEDGVKLRSYC**********************

*******WENLIRQILAKPFKVPILNYTGSGYSTKALGVRREGARKALHDPTAPNALVLYTPPQLSAHDLLKIDKDKIQVHVVVDPVLSNIYLTWKT*********LFRPKHKYIRITKKDSFKPEEHVLSNVLEKAEKACLYDLDDCDIAWL************************************************************FRKDLISAMKLPDSEPLKSDEFWVISDQWKQEWERGVQVPVNPDSLPGPQVTVVSTL*STRYPNNYNEPFKLGNNKH********PAIQEDRLEKMIAELEVRCW*****************DENVICDVCRSPDSEEGNEMVFCDCCNICVHQACYGITTIPSGSWLCRTCVLGKRPECILCPNKGGAMKCARSGNKWAHVSCALWIPEVSIGCVEKMEPITKISSIPQSRWALICILCRERLGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDENAEDGVKLRSYCQK********************

MFTSYDHWENLIRQILAKPFKVPILNYTGSGYSTKALGVRREGARKALHDPTAPNALVLYTPPQLSAHDLLKIDKDKIQVHVVVDPVLSNIYLTWKTNHQYEIRLPLFRPKHKYIRITKKDSFKPEEHVLSNVLEKAEKACLYDLDDCDIAWLNILNGERACMGIMYNTQD********************YSDLKSMNSIYNRNTNEAPAELFRKDLISAMKLPDSEPLKSDEFWVISDQWKQEWERGVQVPVNPDSLPGPQVTVVSTLNSTRYPNNYNEPFKLGNNKHLFPIPPGLPAIQEDRLEKMIAELEVRCWDKVQTIIKEEEGLGLEFDENVICDVCRSPDSEEGNEMVFCDCCNICVHQACYGITTIPSGSWLCRTCVLGKRPECILCPNKGGAMKCARSGNKWAHVSCALWIPEVSIGCVEKMEPITKISSIPQSRWALICILCRERLGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDENAEDGVKLRSYCQKHSLTT***************

*FTSYDHWENLIRQILAKPFKVPILNYTGSGYSTKALGVRREGARKALHDPTAPNALVLYTPPQLSAHDLLKIDKDKIQVHVVVDPVLSNIYLTWKTNHQYEIRLPLFRPKHKYIRITKKDSFKPEEHVLSNVLEKAEKACLYDLDDCDIAWLNILNGERACMGI*******************************************APAELFRKDLISAMKLPDSEPLKSDEFWVISDQWKQEWERGVQVPVNPDSLPGPQVTVVSTLNSTRYPNNYNEPFKLGNNKHLFPIPPGLPAIQEDRLEKMIAELEVRCWDKVQTIIKEEEGLGLEFDENVICDVCRSPDSEEGNEMVFCDCCNICVHQACYGITTIPSGSWLCRTCVLGKRPECILCPNKGGAMKCARSGNKWAHVSCALWIPEVSIGCVEKMEPITKISSIPQSRWALICILCRERLGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDENAEDGVKLRSYCQK********************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		525	2.2.26 [Sep-21-2011]
Q7YZH1		3241	PHD finger protein rhinoc	yes	N/A	0.607	0.098	0.635	1e-135
Q29EQ3		3313	PHD finger protein rhinoc	yes	N/A	0.533	0.084	0.600	1e-110
Q6IE81		842	Protein Jade-1 OS=Homo sa	yes	N/A	0.584	0.364	0.536	1e-104
Q6ZPI0		834	Protein Jade-1 OS=Mus mus	yes	N/A	0.592	0.372	0.530	1e-103
Q5E9T7		509	Protein Jade-1 OS=Bos tau	yes	N/A	0.584	0.603	0.536	1e-102
Q6GQJ2		827	Protein Jade-1 OS=Xenopus	N/A	N/A	0.601	0.382	0.509	1e-102
Q92613		823	Protein Jade-3 OS=Homo sa	no	N/A	0.577	0.368	0.526	1e-101
Q0P4S5		817	Protein Jade-3 OS=Xenopus	no	N/A	0.558	0.358	0.548	1e-100
Q6IE82		823	Protein Jade-3 OS=Mus mus	no	N/A	0.580	0.370	0.529	1e-100
Q9NQC1		790	Protein Jade-2 OS=Homo sa	no	N/A	0.645	0.429	0.490	1e-100

>sp\|Q7YZH1\|RNO_DROME PHD finger protein rhinoceros OS=Drosophila melanogaster GN=rno PE=1 SV=1	Back alignment and function desciption

 Score =  483 bits (1244), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 230/362 (63%), Positives = 272/362 (75%), Gaps = 43/362 (11%)

Query: 193 SDLKSMNSIYNRNTNEAPAELFRKDLISAMKLPDSEPLKSDEFWVISDQWKQEWERGVQV 252
           +D+K M+SIYNR++ EAPAEL+RKDLISAMKLPDSEPL + E+ +++D WKQEWE+GVQV
Sbjct: 130 ADIK-MSSIYNRSSTEAPAELYRKDLISAMKLPDSEPLANYEYLIVTDPWKQEWEKGVQV 188

Query: 253 PVNPDSLPGPQV-----TVVSTLNSTRYPNNYNEPFKLGNNKHLFP-------------- 293
           PVNPDSLP P V      VVS  +  + P N     ++  ++H  P              
Sbjct: 189 PVNPDSLPEPCVYVLPEPVVSPAHDFKLPKNRY--LRITKDEHYSPDLHYLTNVVALAEN 246

Query: 294 -----IPP----------------GLPAIQEDRLEKMIAELEVRCWDKVQTIIKEEEGLG 332
                I P                G   I   + E++I ELEVRCW+++Q I+K EEGLG
Sbjct: 247 TCAYDIDPIDEAWLRLYNSDRAQCGAFPINATQFERVIEELEVRCWEQIQVILKLEEGLG 306

Query: 333 LEFDENVICDVCRSPDSEEGNEMVFCDCCNICVHQACYGITTIPSGSWLCRTCVLGKRPE 392
           +EFDENVICDVCRSPDSEE NEMVFCD CNICVHQACYGIT IPSG WLCRTC +G +P+
Sbjct: 307 IEFDENVICDVCRSPDSEEANEMVFCDNCNICVHQACYGITAIPSGQWLCRTCSMGIKPD 366

Query: 393 CILCPNKGGAMKCARSGNKWAHVSCALWIPEVSIGCVEKMEPITKISSIPQSRWALICIL 452
           C+LCPNKGGAMK  +SG  WAHVSCALWIPEVSIGCV++MEPITKISSIPQSRW+LIC+L
Sbjct: 367 CVLCPNKGGAMKSNKSGKHWAHVSCALWIPEVSIGCVDRMEPITKISSIPQSRWSLICVL 426

Query: 453 CRERLGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDENAEDGVKLRSYCQKHSLTTKK 512
           CR+R+G+CIQCSVK CKTAYHVTCAF+HGLEMRAIIE+ NAEDGVKLRSYCQKHS++  K
Sbjct: 427 CRKRVGSCIQCSVKPCKTAYHVTCAFQHGLEMRAIIEEGNAEDGVKLRSYCQKHSMSKGK 486

Query: 513 TE 514
            E
Sbjct: 487 KE 488

May function as a negative regulator of the EGFR/Ras/MAPK signaling pathway during eye development.
Drosophila melanogaster (taxid: 7227)

>sp\|Q29EQ3\|RNO_DROPS PHD finger protein rhinoceros OS=Drosophila pseudoobscura pseudoobscura GN=rno PE=3 SV=2	Back alignment and function description

>sp\|Q6IE81\|JADE1_HUMAN Protein Jade-1 OS=Homo sapiens GN=PHF17 PE=1 SV=1	Back alignment and function description

>sp\|Q6ZPI0\|JADE1_MOUSE Protein Jade-1 OS=Mus musculus GN=Phf17 PE=1 SV=2	Back alignment and function description

>sp\|Q5E9T7\|JADE1_BOVIN Protein Jade-1 OS=Bos taurus GN=PHF17 PE=2 SV=1	Back alignment and function description

>sp\|Q6GQJ2\|JADE1_XENLA Protein Jade-1 OS=Xenopus laevis GN=phf17 PE=2 SV=1	Back alignment and function description

>sp\|Q92613\|JADE3_HUMAN Protein Jade-3 OS=Homo sapiens GN=PHF16 PE=1 SV=1	Back alignment and function description

>sp\|Q0P4S5\|JADE3_XENTR Protein Jade-3 OS=Xenopus tropicalis GN=phf16 PE=2 SV=1	Back alignment and function description

>sp\|Q6IE82\|JADE3_MOUSE Protein Jade-3 OS=Mus musculus GN=Phf16 PE=2 SV=1	Back alignment and function description

>sp\|Q9NQC1\|JADE2_HUMAN Protein Jade-2 OS=Homo sapiens GN=PHF15 PE=1 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		525
307186407		2950	PHD finger protein rhinoceros [Camponotu	0.660	0.117	0.651	1e-147
328705734		2352	PREDICTED: hypothetical protein LOC10016	0.638	0.142	0.664	1e-147
332021584		1438	PHD finger protein rhinoceros [Acromyrme	0.659	0.240	0.640	1e-146
350407207		2766	PREDICTED: hypothetical protein LOC10074	0.704	0.133	0.606	1e-146
345496695		3084	PREDICTED: hypothetical protein LOC10011	0.611	0.104	0.673	1e-145
383856687		1885	PREDICTED: uncharacterized protein LOC10	0.613	0.170	0.669	1e-145
328792724		1859	PREDICTED: hypothetical protein LOC41337	0.613	0.173	0.666	1e-145
242022466		2563	PHD finger protein, putative [Pediculus	0.579	0.118	0.685	1e-144
157107709		2274	phd finger protein [Aedes aegypti] gi\|10	0.584	0.135	0.663	1e-143
357627321		2594	putative PHD finger protein [Danaus plex	0.590	0.119	0.662	1e-140

>gi\|307186407\|gb\|EFN72041.1\| PHD finger protein rhinoceros [Camponotus floridanus]	Back alignment and taxonomy information

 Score =  530 bits (1364), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 254/390 (65%), Positives = 294/390 (75%), Gaps = 43/390 (11%)

Query: 158 GERACMGIMYNTQDDEEATSSPMDSVHSSRGGSSY-----SDLKSMNSIYNRNTNEAPAE 212
           G  A    M  ++++E   SS       S+GG+S+     SD+K + SIYNR++ EAPAE
Sbjct: 34  GSSALAATMGPSEEEETMASS-------SQGGASWTARSVSDIK-IPSIYNRSSAEAPAE 85

Query: 213 LFRKDLISAMKLPDSEPLKSDEFWVISDQWKQEWERGVQVPVNPDSLPGPQVTVVST--L 270
           LFRKDLISAMKLPDSEPL  +E+WVI+DQWKQEWERGVQVPVNPDSLP P VTV  T  L
Sbjct: 86  LFRKDLISAMKLPDSEPLSPNEYWVITDQWKQEWERGVQVPVNPDSLPEPTVTVTQTSPL 145

Query: 271 NSTRYPNNYNEPFKLGNNKHLFPIP----------------------------PGLPAIQ 302
              ++     + +    + HL   P                             G   + 
Sbjct: 146 KPKKFVRISRDDYFNSEDHHLSTTPARAEKACAYDLDDTDIAWLEVFNGERAQAGQLPVT 205

Query: 303 EDRLEKMIAELEVRCWDKVQTIIKEEEGLGLEFDENVICDVCRSPDSEEGNEMVFCDCCN 362
           E +LE++I ELEVRCW+++QTI+K EEGLG+E+DENVICDVCRSPDSEEGNEMVFCDCCN
Sbjct: 206 ESQLERVIEELEVRCWERIQTIVKNEEGLGIEYDENVICDVCRSPDSEEGNEMVFCDCCN 265

Query: 363 ICVHQACYGITTIPSGSWLCRTCVLGKRPECILCPNKGGAMKCARSGNKWAHVSCALWIP 422
           ICVHQACYGIT+IP GSWLCRTC L +RP+C+LCPNKGGAMKC RSG KWAHVSCALWIP
Sbjct: 266 ICVHQACYGITSIPDGSWLCRTCSLSQRPDCVLCPNKGGAMKCTRSGQKWAHVSCALWIP 325

Query: 423 EVSIGCVEKMEPITKISSIPQSRWALICILCRERLGACIQCSVKTCKTAYHVTCAFKHGL 482
           EVSIGCVE+MEPITKISSIPQSRWALIC+LCRER+GACIQCS+KTCKTAYHVTCAFK+GL
Sbjct: 326 EVSIGCVERMEPITKISSIPQSRWALICVLCRERVGACIQCSIKTCKTAYHVTCAFKYGL 385

Query: 483 EMRAIIEDENAEDGVKLRSYCQKHSLTTKK 512
           EM+AIIEDE A+DGVKLRSYCQKHS T  K
Sbjct: 386 EMKAIIEDEMADDGVKLRSYCQKHSRTNTK 415

Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|328705734\|ref\|XP_001948004.2\| PREDICTED: hypothetical protein LOC100165704 [Acyrthosiphon pisum]	Back alignment and taxonomy information

>gi\|332021584\|gb\|EGI61949.1\| PHD finger protein rhinoceros [Acromyrmex echinatior]	Back alignment and taxonomy information

>gi\|350407207\|ref\|XP_003488016.1\| PREDICTED: hypothetical protein LOC100744014 [Bombus impatiens]	Back alignment and taxonomy information

>gi\|345496695\|ref\|XP_001602710.2\| PREDICTED: hypothetical protein LOC100118826 [Nasonia vitripennis]	Back alignment and taxonomy information

>gi\|383856687\|ref\|XP_003703839.1\| PREDICTED: uncharacterized protein LOC100877323 [Megachile rotundata]	Back alignment and taxonomy information

>gi\|328792724\|ref\|XP_396822.4\| PREDICTED: hypothetical protein LOC413377 [Apis mellifera]	Back alignment and taxonomy information

>gi\|242022466\|ref\|XP_002431661.1\| PHD finger protein, putative [Pediculus humanus corporis] gi\|212516969\|gb\|EEB18923.1\| PHD finger protein, putative [Pediculus humanus corporis]	Back alignment and taxonomy information

>gi\|157107709\|ref\|XP_001649902.1\| phd finger protein [Aedes aegypti] gi\|108879514\|gb\|EAT43739.1\| AAEL004834-PA [Aedes aegypti]	Back alignment and taxonomy information

>gi\|357627321\|gb\|EHJ77057.1\| putative PHD finger protein [Danaus plexippus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		525
FB\|FBgn0035106		3241	rno "rhinoceros" [Drosophila m	0.396	0.064	0.798	4.3e-121
RGD\|1306920		832	Phf17 "PHD finger protein 17"	0.396	0.25	0.668	4.6e-101
UNIPROTKB\|Q6IE81		842	PHF17 "Protein Jade-1" [Homo s	0.396	0.247	0.668	5.9e-101
UNIPROTKB\|E1C152		847	PHF17 "Uncharacterized protein	0.396	0.245	0.677	9.6e-101
UNIPROTKB\|G3X6H5		823	PHF16 "Uncharacterized protein	0.472	0.301	0.584	9.6e-101
UNIPROTKB\|F1RRB5		842	PHF17 "Uncharacterized protein	0.396	0.247	0.668	1.2e-100
MGI\|MGI:1925835		834	Phf17 "PHD finger protein 17"	0.396	0.249	0.668	2.5e-100
UNIPROTKB\|F1RWY1		823	PHF16 "Uncharacterized protein	0.396	0.252	0.668	2.5e-100
UNIPROTKB\|E2RJY9		833	PHF16 "Uncharacterized protein	0.396	0.249	0.663	2.5e-100
UNIPROTKB\|Q92613		823	PHF16 "Protein Jade-3" [Homo s	0.472	0.301	0.580	3.2e-100

FB\|FBgn0035106 rno "rhinoceros" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 964 (344.4 bits), Expect = 4.3e-121, Sum P(2) = 4.3e-121
 Identities = 166/208 (79%), Positives = 189/208 (90%)

Query:   301 IQEDRLEKMIAELEVRCWDKVQTIIKEEEGLGLEFDENVICDVCRSPDSEEGNEMVFCDC 360
             I   + E++I ELEVRCW+++Q I+K EEGLG+EFDENVICDVCRSPDSEE NEMVFCD 
Sbjct:   275 INATQFERVIEELEVRCWEQIQVILKLEEGLGIEFDENVICDVCRSPDSEEANEMVFCDN 334

Query:   361 CNICVHQACYGITTIPSGSWLCRTCVLGKRPECILCPNKGGAMKCARSGNKWAHVSCALW 420
             CNICVHQACYGIT IPSG WLCRTC +G +P+C+LCPNKGGAMK  +SG  WAHVSCALW
Sbjct:   335 CNICVHQACYGITAIPSGQWLCRTCSMGIKPDCVLCPNKGGAMKSNKSGKHWAHVSCALW 394

Query:   421 IPEVSIGCVEKMEPITKISSIPQSRWALICILCRERLGACIQCSVKTCKTAYHVTCAFKH 480
             IPEVSIGCV++MEPITKISSIPQSRW+LIC+LCR+R+G+CIQCSVK CKTAYHVTCAF+H
Sbjct:   395 IPEVSIGCVDRMEPITKISSIPQSRWSLICVLCRKRVGSCIQCSVKPCKTAYHVTCAFQH 454

Query:   481 GLEMRAIIEDENAEDGVKLRSYCQKHSL 508
             GLEMRAIIE+ NAEDGVKLRSYCQKHS+
Sbjct:   455 GLEMRAIIEEGNAEDGVKLRSYCQKHSM 482

GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS

GO:0003677 "DNA binding" evidence=ISS

GO:0042059 "negative regulation of epidermal growth factor receptor signaling pathway" evidence=IMP;IDA

GO:0005634 "nucleus" evidence=IDA

GO:0042051 "compound eye photoreceptor development" evidence=IMP

GO:0008270 "zinc ion binding" evidence=IEA

RGD\|1306920 Phf17 "PHD finger protein 17" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q6IE81 PHF17 "Protein Jade-1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|E1C152 PHF17 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|G3X6H5 PHF16 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RRB5 PHF17 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

MGI\|MGI:1925835 Phf17 "PHD finger protein 17" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RWY1 PHF16 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RJY9 PHF16 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q92613 PHF16 "Protein Jade-3" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q6IE81	JADE1_HUMAN	No assigned EC number	0.5362	0.5847	0.3646	yes	N/A
Q7YZH1	RNO_DROME	No assigned EC number	0.6353	0.6076	0.0984	yes	N/A
Q29EQ3	RNO_DROPS	No assigned EC number	0.6006	0.5333	0.0845	yes	N/A
Q6ZPI0	JADE1_MOUSE	No assigned EC number	0.5300	0.5923	0.3729	yes	N/A
Q5E9T7	JADE1_BOVIN	No assigned EC number	0.5362	0.5847	0.6031	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		525
COG5141		669	COG5141, COG5141, PHD zinc finger-containing prote	5e-52
pfam13832		109	pfam13832, zf-HC5HC2H_2, PHD-zinc-finger like doma	4e-41
pfam13771		89	pfam13771, zf-HC5HC2H, PHD-like zinc-binding domai	2e-28
pfam00628		51	pfam00628, PHD, PHD-finger	6e-10
pfam13831		33	pfam13831, PHD_2, PHD-finger	3e-09
smart00249		47	smart00249, PHD, PHD zinc finger	3e-07
pfam08658		191	pfam08658, Rad54_N, Rad54 N terminal	2e-04
pfam10513		145	pfam10513, EPL1, Enhancer of polycomb-like	0.002

>gnl\|CDD\|227470 COG5141, COG5141, PHD zinc finger-containing protein [General function prediction only]	Back alignment and domain information

 Score =  187 bits (476), Expect = 5e-52
 Identities = 84/205 (40%), Positives = 108/205 (52%), Gaps = 9/205 (4%)

Query: 304 DRLEKMIAELEVRCWDKVQTIIKEEEGLGLEFDENVICDVCRSPDSEEGNEMVFCDCCNI 363
            RLEK     E    DK    I+  +    EFD+  IC  C S  +E  N +VFCD C I
Sbjct: 165 TRLEKEWFFFEHGLPDKHVEPIEPSD----EFDD--ICTKCTSTHNENSNAIVFCDGCEI 218

Query: 364 CVHQACYGITTIPSGSWLCRTCVLGKRP--ECILCPNKGGAMKCARSGNKWAHVSCALWI 421
           CVHQ+CYGI  +P G WLCR C+ G+     C  CP+  GA     S  +W HV CA++ 
Sbjct: 219 CVHQSCYGIQFLPEGFWLCRKCIYGEYQIRCCSFCPSSDGAF-KQTSDGRWGHVICAMFN 277

Query: 422 PEVSIGCVEKMEPITKISSIPQSRWALICILCRERLGACIQCSVKTCKTAYHVTCAFKHG 481
           PE+S G +   +PI  I+S+  SRW L C++C+E  G CIQCS   C  AYHVTCA + G
Sbjct: 278 PELSFGHLLSKDPIDNIASVSSSRWKLGCLICKEFGGTCIQCSYFNCTRAYHVTCARRAG 337

Query: 482 LEMRAIIEDENAEDGVKLRSYCQKH 506
                I         +     C+KH
Sbjct: 338 YFDLNIYSHNGISYCIDHEPLCRKH 362

Length = 669

>gnl\|CDD\|206003 pfam13832, zf-HC5HC2H_2, PHD-zinc-finger like domain	Back alignment and domain information

>gnl\|CDD\|222368 pfam13771, zf-HC5HC2H, PHD-like zinc-binding domain	Back alignment and domain information

>gnl\|CDD\|201356 pfam00628, PHD, PHD-finger	Back alignment and domain information

>gnl\|CDD\|222406 pfam13831, PHD_2, PHD-finger	Back alignment and domain information

>gnl\|CDD\|214584 smart00249, PHD, PHD zinc finger	Back alignment and domain information

>gnl\|CDD\|219956 pfam08658, Rad54_N, Rad54 N terminal	Back alignment and domain information

>gnl\|CDD\|220792 pfam10513, EPL1, Enhancer of polycomb-like	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		525
KOG0954\|consensus		893		100.0
COG5141		669	PHD zinc finger-containing protein [General functi	100.0
KOG0955\|consensus		1051		100.0
KOG0956\|consensus		900		100.0
KOG0957\|consensus		707		99.96
PF13832		110	zf-HC5HC2H_2: PHD-zinc-finger like domain	99.92
KOG0954\|consensus		893		99.73
PF13771		90	zf-HC5HC2H: PHD-like zinc-binding domain	99.68
PF08658		196	Rad54_N: Rad54 N terminal; InterPro: IPR013967 Thi	99.22
KOG1080\|consensus		1005		99.21
PF13831		36	PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A.	99.08
PF10513		160	EPL1: Enhancer of polycomb-like; InterPro: IPR0195	99.04
PF10513		160	EPL1: Enhancer of polycomb-like; InterPro: IPR0195	98.43
PF00628		51	PHD: PHD-finger; InterPro: IPR019787 Zinc finger (	98.22
smart00249		47	PHD PHD zinc finger. The plant homeodomain (PHD) f	98.06
KOG1512\|consensus		381		98.05
KOG1244\|consensus		336		97.93
KOG4323\|consensus		464		97.78
KOG4323\|consensus		464		97.54
PF15446		175	zf-PHD-like: PHD/FYVE-zinc-finger like domain	97.21
KOG4299\|consensus		613		97.07
KOG0825\|consensus		1134		97.0
KOG0390\|consensus		776		96.8
KOG1084\|consensus		375		96.74
COG5034		271	TNG2 Chromatin remodeling protein, contains PhD zi	96.32
KOG1973\|consensus		274		96.23
PF14446		54	Prok-RING_1: Prokaryotic RING finger family 1	93.58
KOG0383\|consensus		696		93.31
smart00249		47	PHD PHD zinc finger. The plant homeodomain (PHD) f	92.74
KOG4443\|consensus		694		92.67
KOG1245\|consensus		1404		92.58
PF00628		51	PHD: PHD-finger; InterPro: IPR019787 Zinc finger (	91.77
cd04718		148	BAH_plant_2 BAH, or Bromo Adjacent Homology domain	90.96
KOG1473\|consensus		1414		90.39
KOG1244\|consensus		336		89.35
PF02318		118	FYVE_2: FYVE-type zinc finger; InterPro: IPR003315	85.88
KOG1512\|consensus		381		85.71
KOG1044\|consensus		670		83.24
KOG1973\|consensus		274		81.7
PF00130		53	C1_1: Phorbol esters/diacylglycerol binding domain	80.07

>KOG0954\|consensus	Back alignment and domain information

Probab=100.00  E-value=1.9e-83  Score=690.33  Aligned_cols=326  Identities=58%  Similarity=1.068  Sum_probs=300.6

Q ss_pred             cccccCCCCCCccccccccccccCCCCCccccccchhhhhccCCCCCCCCCCCeEEechhhhHhhhcCccccCCCCCCCC
Q psy5645         182 SVHSSRGGSSYSDLKSMNSIYNRNTNEAPAELFRKDLISAMKLPDSEPLKSDEFWVISDQWKQEWERGVQVPVNPDSLPG  261 (525)
Q Consensus       182 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~Pae~~r~d~isa~k~~ds~~~~~~~~~~~~d~wkqew~~gvqvp~~p~~~p~  261 (525)
                      |.+..+...+.++ |.+++|++|...++|+|+||+|||+|||++||+++.+++|++++|+|||||++|||||++|++||+
T Consensus        82 sis~t~~~~~~~~-kK~~s~~h~~adkkpkel~Rqdli~amkl~dse~~~p~~y~~~~D~wk~ewekgvQvpaspd~lpq  160 (893)
T KOG0954|consen   82 SISLTWLLKSSSN-KKRSSISHRGADKKPKELYRQDLISAMKLPDSEHLNPDEYLDFADPWKQEWEKGVQVPASPDTLPQ  160 (893)
T ss_pred             chhhhhcccchhh-hhhhhccccccccchHHHHHhhhhhhccCccccccCccceeecCCccchhhhccccccCCCCcCCC
Confidence            3444455554454 449999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcEEEccCCC--CCCC--CCCCc-----------------------cccCCCCcc-ccC------CCCCCCCCCCHHHHH
Q psy5645         262 PQVTVVSTLN--STRY--PNNYN-----------------------EPFKLGNNK-HLF------PIPPGLPAIQEDRLE  307 (525)
Q Consensus       262 ~~~~~~~~~~--~~~~--p~~~~-----------------------~~y~~~~~~-~~~------~~~~~~~~~~~~~~e  307 (525)
                      |+|++++..-  ..+|  |++|.                       -+|++|.+| .|+      ...+|.+++++.+||
T Consensus       161 p~v~~dse~v~~~~~fs~pkkyivc~~~~~~e~~yn~~~~~lae~tcrydid~~d~awL~~~n~e~~~~G~~~l~~~~~e  240 (893)
T KOG0954|consen  161 PSVRVDSEDVQPETDFSRPKKYIVCSDGEVPELGYNLLIKDLAESTCRYDIDDMDPAWLQLVNEERAEMGSLELDEGTFE  240 (893)
T ss_pred             cceeccchhcchhhhhcCCcceEEeCCCCCcccchhhhHHHHhhhhhhcccccccHHHHHHhcchHHhhCCcccchHHHH
Confidence            9999998863  2356  88871                       159999998 443      248999999999999


Q ss_pred             HHHHHHhccchhhhhhhhhcccCCcccccCcccccccCCCCCCCCCcEEEccCCCceeccccccccccCCCCccceeecC
Q psy5645         308 KMIAELEVRCWDKVQTIIKEEEGLGLEFDENVICDVCRSPDSEEGNEMVFCDCCNICVHQACYGITTIPSGSWLCRTCVL  387 (525)
Q Consensus       308 ~~i~~lE~~~~~~~~~~~~~~~~~~~e~ded~~C~VC~~~e~ed~N~lv~CD~C~i~VHq~CYgi~~iPeg~WlC~~C~~  387 (525)
                      +||++||.++|++|+.++.++.|++++++|+..|+||+.+++++.|+|||||+||++|||.||||..+|+|.|+|+.|..
T Consensus       241 RiieelE~~c~kqi~~~l~~eeglgie~dedviCDvCrspD~e~~neMVfCd~Cn~cVHqaCyGIle~p~gpWlCr~Cal  320 (893)
T KOG0954|consen  241 RIIEELERRCKKQINHALETEEGLGIEYDEDVICDVCRSPDSEEANEMVFCDKCNICVHQACYGILEVPEGPWLCRTCAL  320 (893)
T ss_pred             HHHHHHHHHHHHHHHhhhhhcccceeeccccceeceecCCCccccceeEEeccchhHHHHhhhceeecCCCCeeehhccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCccccCCCCCCCCccccCCCcccccccccCCCccEEccCcccccccCCCCcccccccccccccCCCCCceeecCCCC
Q psy5645         388 GKRPECILCPNKGGAMKCARSGNKWAHVSCALWIPEVSIGCVEKMEPITKISSIPQSRWALICILCRERLGACIQCSVKT  467 (525)
Q Consensus       388 ~~~~~C~LCp~~gGalK~t~~g~~WvHv~CAlwipev~f~~~~~~epI~~i~~I~~~r~~l~C~iC~~~~GacIqCs~~~  467 (525)
                      +..+.|+|||++|||||.+.+|.+|+|++||||||||+|++.+.|+||++|+.|+.+||.+.|.+|+.+.||||||++++
T Consensus       321 g~~ppCvLCPkkGGamK~~~sgT~wAHvsCALwIPEVsie~~ekmePItkfs~IpesRwslvC~LCk~k~GACIqCs~k~  400 (893)
T KOG0954|consen  321 GIEPPCVLCPKKGGAMKPTKSGTKWAHVSCALWIPEVSIECPEKMEPITKFSHIPESRWSLVCNLCKVKSGACIQCSNKT  400 (893)
T ss_pred             cCCCCeeeccccCCcccccCCCCeeeEeeeeeccceeeccCHhhcCcccccCCCcHHHHHHHHHHhcccCcceEEecccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCceeeccchhccCCeEEEEeeccccCCCceEEEcCCCCCCCCc
Q psy5645         468 CKTAYHVTCAFKHGLEMRAIIEDENAEDGVKLRSYCQKHSLTTK  511 (525)
Q Consensus       468 C~~aFHvtCA~~aGl~m~~~~~~~~~~d~~~~~~yC~kHs~~~~  511 (525)
                      |.++||++||+.+|+.|+++..   ..|.+.++.||.+|+....
T Consensus       401 C~t~fHv~CA~~aG~~~~~~~~---~~D~v~~~s~c~khs~~~~  441 (893)
T KOG0954|consen  401 CRTAFHVTCAFEAGLEMKTILK---ENDEVKFKSYCSKHSDHRE  441 (893)
T ss_pred             hhhhccchhhhhcCCeeeeeec---cCCchhheeeccccccccc
Confidence            9999999999999999997643   2577889999999987764

>COG5141 PHD zinc finger-containing protein [General function prediction only]	Back alignment and domain information

>KOG0955\|consensus	Back alignment and domain information

>KOG0956\|consensus	Back alignment and domain information

>KOG0957\|consensus	Back alignment and domain information

>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain	Back alignment and domain information

>KOG0954\|consensus	Back alignment and domain information

>PF13771 zf-HC5HC2H: PHD-like zinc-binding domain	Back alignment and domain information

>PF08658 Rad54_N: Rad54 N terminal; InterPro: IPR013967 This is the N-terminal of the DNA repair protein Rad54 []	Back alignment and domain information

>KOG1080\|consensus	Back alignment and domain information

>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A	Back alignment and domain information

>PF10513 EPL1: Enhancer of polycomb-like; InterPro: IPR019542 This domain is found at the N-terminal of EPL1 (Enhancer of polycomb-like) proteins	Back alignment and domain information

>PF10513 EPL1: Enhancer of polycomb-like; InterPro: IPR019542 This domain is found at the N-terminal of EPL1 (Enhancer of polycomb-like) proteins	Back alignment and domain information

>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>smart00249 PHD PHD zinc finger	Back alignment and domain information

>KOG1512\|consensus	Back alignment and domain information

>KOG1244\|consensus	Back alignment and domain information

>KOG4323\|consensus	Back alignment and domain information

>KOG4323\|consensus	Back alignment and domain information

>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain	Back alignment and domain information

>KOG4299\|consensus	Back alignment and domain information

>KOG0825\|consensus	Back alignment and domain information

>KOG0390\|consensus	Back alignment and domain information

>KOG1084\|consensus	Back alignment and domain information

>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics]	Back alignment and domain information

>KOG1973\|consensus	Back alignment and domain information

>PF14446 Prok-RING_1: Prokaryotic RING finger family 1	Back alignment and domain information

>KOG0383\|consensus	Back alignment and domain information

>smart00249 PHD PHD zinc finger	Back alignment and domain information

>KOG4443\|consensus	Back alignment and domain information

>KOG1245\|consensus	Back alignment and domain information

>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function	Back alignment and domain information

>KOG1473\|consensus	Back alignment and domain information

>KOG1244\|consensus	Back alignment and domain information

>PF02318 FYVE_2: FYVE-type zinc finger; InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A	Back alignment and domain information

>KOG1512\|consensus	Back alignment and domain information

>KOG1044\|consensus	Back alignment and domain information

>KOG1973\|consensus	Back alignment and domain information

>PF00130 C1_1: Phorbol esters/diacylglycerol binding domain (C1 domain); InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		525
1z3i_X		644	Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMA		7e-16
2l43_A		88	Structural Basis For Histone Code Recognition By Br		5e-11
2ku3_A		71	Solution Structure Of Brd1 Phd1 Finger Length = 71		9e-11
2lq6_A		87	Solution Structure Of Brd1 Phd2 Finger Length = 87		1e-08

>pdb|1Z3I|X Chain X, Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMAIN OF EUKARYOTIC Rad54 Length = 644

Back alignment and structure

Iteration: 1
 Score = 82.0 bits (201), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 44/55 (80%)
Query: 37 LGVRREGARKALHDPTAPNALVLYTPPQLSAHDLLKIDKDKIQVHVVVDPVLSNI 91
          LG+RR G RKALHDP    ALVLY PP +SAHDL+K DK+K+ VHVVVDPVLS +
Sbjct: 1  LGLRRAGVRKALHDPFEDGALVLYEPPAISAHDLIKADKEKLPVHVVVDPVLSKV 55

PyMOL of 1z3i

>pdb|2L43|A Chain A, Structural Basis For Histone Code Recognition By Brpf2-Phd1 Finger Length = 88

Back alignment and structure

>pdb|2KU3|A Chain A, Solution Structure Of Brd1 Phd1 Finger Length = 71

Back alignment and structure

>pdb|2LQ6|A Chain A, Solution Structure Of Brd1 Phd2 Finger Length = 87

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		525
2l43_A		88	N-teminal domain from histone H3.3, linker, PHD1 f	8e-23
2ku3_A		71	Bromodomain-containing protein 1; PHD finger, chro	4e-21
2yt5_A		66	Metal-response element-binding transcription facto	7e-18
1wev_A		88	Riken cDNA 1110020M19; structural genomics, PHD do	5e-17
1z3i_X		644	Similar to RAD54-like; recombination ATPase helica	6e-15
1x4i_A		70	Inhibitor of growth protein 3; structural genomics	1e-09
2k16_A		75	Transcription initiation factor TFIID subunit 3; p	3e-09
2vnf_A		60	ING 4, P29ING4, inhibitor of growth protein 4; ace	1e-08
2e6r_A		92	Jumonji/ARID domain-containing protein 1D; PHD dom	5e-08
2kwj_A		114	Zinc finger protein DPF3; acetyl-lysine, transcrip	7e-08
3c6w_A		59	P28ING5, inhibitor of growth protein 5; chromatin,	3e-07
2g6q_A		62	Inhibitor of growth protein 2; protein-peptide com	4e-07
2ysm_A		111	Myeloid/lymphoid or mixed-lineage leukemia protein	5e-07
2ysm_A		111	Myeloid/lymphoid or mixed-lineage leukemia protein	2e-05
1wen_A		71	Inhibitor of growth family, member 4; ING1-like pr	6e-07
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	7e-07
1f62_A		51	Transcription factor WSTF; Zn-finger; NMR {Homo sa	8e-07
1weu_A		91	Inhibitor of growth family, member 4; structural g	8e-07
3v43_A		112	Histone acetyltransferase KAT6A; MOZ, PHD finger,	9e-07
3v43_A		112	Histone acetyltransferase KAT6A; MOZ, PHD finger,	4e-04
1fp0_A		88	KAP-1 corepressor; PHD domain, C3HC4 type zinc bin	2e-06
1xwh_A		66	Autoimmune regulator; PHD domain, Zn binding domai	4e-06
1wee_A		72	PHD finger family protein; structural genomics, PH	4e-06
2puy_A		60	PHD finger protein 21A; PHD finger, histone CODE,	1e-05
1mm2_A		61	MI2-beta; PHD, zinc finger, protein scaffold, DNA	2e-05
2yql_A		56	PHD finger protein 21A; PHD domain, structural gen	2e-05
2l5u_A		61	Chromodomain-helicase-DNA-binding protein 4; CHD4,	6e-05
1we9_A		64	PHD finger family protein; structural genomics, PH	9e-05
2jmi_A		90	Protein YNG1, ING1 homolog 1; PHD, histone, recogn	1e-04
3ask_A		226	E3 ubiquitin-protein ligase UHRF1; histone reader	2e-04
1wem_A		76	Death associated transcription factor 1; structura	2e-04
3asl_A		70	E3 ubiquitin-protein ligase UHRF1; histone reader	3e-04
2ro1_A		189	Transcription intermediary factor 1-beta; KAP, TIF	3e-04
2e6s_A		77	E3 ubiquitin-protein ligase UHRF2; PHD domain, str	3e-04
3shb_A		77	E3 ubiquitin-protein ligase UHRF1; unmodified hist	3e-04

>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88	Back alignment and structure

 Score = 91.6 bits (227), Expect = 8e-23
 Identities = 27/66 (40%), Positives = 39/66 (59%), Gaps = 1/66 (1%)

Query: 334 EFDENVICDVCRSPDSEEGNEMVFCDCCNICVHQACYGITTIPSGSWLCRTCVLGK-RPE 392
             DE+ +C +C   +S+  N ++FCD CN+ VHQ CYG+  IP G WLCR C+  + RP 
Sbjct: 21  LIDEDAVCSICMDGESQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRHCLQSRARPA 80

Query: 393 CILCPN 398
                +
Sbjct: 81  LEHHHH 86

PyMOL of 2l43

>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71	Back alignment and structure

>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66	Back alignment and structure

>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88	Back alignment and structure

>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644	Back alignment and structure

>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70	Back alignment and structure

>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75	Back alignment and structure

>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Length = 60	Back alignment and structure

>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92	Back alignment and structure

>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114	Back alignment and structure

>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Length = 59	Back alignment and structure

>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Length = 62	Back alignment and structure

>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111	Back alignment and structure

>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111	Back alignment and structure

>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Length = 71	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51	Back alignment and structure

>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Length = 91	Back alignment and structure

>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112	Back alignment and structure

>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112	Back alignment and structure

>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88	Back alignment and structure

>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66	Back alignment and structure

>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 72	Back alignment and structure

>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60	Back alignment and structure

>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61	Back alignment and structure

>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56	Back alignment and structure

>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61	Back alignment and structure

>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64	Back alignment and structure

>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Length = 90	Back alignment and structure

>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226	Back alignment and structure

>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76	Back alignment and structure

>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70	Back alignment and structure

>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189	Back alignment and structure

>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77	Back alignment and structure

>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		525
2lq6_A		87	Bromodomain-containing protein 1; PHD finger, meta	99.63
2ku3_A		71	Bromodomain-containing protein 1; PHD finger, chro	99.29
2l43_A		88	N-teminal domain from histone H3.3, linker, PHD1 f	99.22
1wev_A		88	Riken cDNA 1110020M19; structural genomics, PHD do	99.12
2yt5_A		66	Metal-response element-binding transcription facto	99.1
1f62_A		51	Transcription factor WSTF; Zn-finger; NMR {Homo sa	98.81
2ysm_A		111	Myeloid/lymphoid or mixed-lineage leukemia protein	98.8
4gne_A		107	Histone-lysine N-methyltransferase NSD3; zinc fing	98.79
2kwj_A		114	Zinc finger protein DPF3; acetyl-lysine, transcrip	98.76
1xwh_A		66	Autoimmune regulator; PHD domain, Zn binding domai	98.74
1mm2_A		61	MI2-beta; PHD, zinc finger, protein scaffold, DNA	98.74
2l5u_A		61	Chromodomain-helicase-DNA-binding protein 4; CHD4,	98.73
2yql_A		56	PHD finger protein 21A; PHD domain, structural gen	98.71
3v43_A		112	Histone acetyltransferase KAT6A; MOZ, PHD finger,	98.69
2lri_C		66	Autoimmune regulator; Zn binding protein domain, a	98.68
2e6r_A		92	Jumonji/ARID domain-containing protein 1D; PHD dom	98.67
2puy_A		60	PHD finger protein 21A; PHD finger, histone CODE,	98.67
1fp0_A		88	KAP-1 corepressor; PHD domain, C3HC4 type zinc bin	98.61
2e6s_A		77	E3 ubiquitin-protein ligase UHRF2; PHD domain, str	98.49
2vnf_A		60	ING 4, P29ING4, inhibitor of growth protein 4; ace	98.48
3asl_A		70	E3 ubiquitin-protein ligase UHRF1; histone reader	98.45
1wen_A		71	Inhibitor of growth family, member 4; ING1-like pr	98.43
3c6w_A		59	P28ING5, inhibitor of growth protein 5; chromatin,	98.38
3shb_A		77	E3 ubiquitin-protein ligase UHRF1; unmodified hist	98.35
2g6q_A		62	Inhibitor of growth protein 2; protein-peptide com	98.34
2jmi_A		90	Protein YNG1, ING1 homolog 1; PHD, histone, recogn	98.33
3o36_A		184	Transcription intermediary factor 1-alpha; TRIM24,	98.27
3u5n_A		207	E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b	98.26
2kwj_A		114	Zinc finger protein DPF3; acetyl-lysine, transcrip	98.26
1weu_A		91	Inhibitor of growth family, member 4; structural g	98.23
2k16_A		75	Transcription initiation factor TFIID subunit 3; p	98.21
3v43_A		112	Histone acetyltransferase KAT6A; MOZ, PHD finger,	98.16
2ro1_A		189	Transcription intermediary factor 1-beta; KAP, TIF	98.14
2ysm_A		111	Myeloid/lymphoid or mixed-lineage leukemia protein	98.12
3ask_A		226	E3 ubiquitin-protein ligase UHRF1; histone reader	98.08
2lv9_A		98	Histone-lysine N-methyltransferase MLL5; zinc fing	98.06
1z3i_X		644	Similar to RAD54-like; recombination ATPase helica	98.04
1x4i_A		70	Inhibitor of growth protein 3; structural genomics	97.95
3o70_A		68	PHD finger protein 13; PHF13, structural genomics	97.65
1we9_A		64	PHD finger family protein; structural genomics, PH	97.57
2rsd_A		68	E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant	97.47
1wew_A		78	DNA-binding family protein; structural genomics, P	97.43
1wee_A		72	PHD finger family protein; structural genomics, PH	97.43
2vpb_A		65	Hpygo1, pygopus homolog 1; gene regulation, WNT si	97.34
1wem_A		76	Death associated transcription factor 1; structura	97.25
3o7a_A		52	PHD finger protein 13 variant; PHF13, zinc finger,	97.19
2ri7_A		174	Nucleosome-remodeling factor subunit BPTF; zinc fi	97.17
2kgg_A		52	Histone demethylase jarid1A; PHD finger, histone m	97.14
2lbm_A		142	Transcriptional regulator ATRX; metal binding prot	97.1
1wep_A		79	PHF8; structural genomics, PHD domain, riken struc	97.05
2xb1_A		105	Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro;	96.92
3ql9_A		129	Transcriptional regulator ATRX; zinc finger, trans	96.82
3kqi_A		75	GRC5, PHD finger protein 2; metal-binding, zinc-fi	96.63
3lqh_A		183	Histone-lysine N-methyltransferase MLL; PHD finger	95.4
3kv5_D		488	JMJC domain-containing histone demethylation prote	94.59
1wew_A		78	DNA-binding family protein; structural genomics, P	94.13
3kv4_A		447	PHD finger protein 8; epigenetics, histone CODE, c	93.89
3pur_A		528	Lysine-specific demethylase 7 homolog; oxidoreduct	93.38
1we9_A		64	PHD finger family protein; structural genomics, PH	92.99
2rsd_A		68	E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant	92.98
2g6q_A		62	Inhibitor of growth protein 2; protein-peptide com	92.76
1wee_A		72	PHD finger family protein; structural genomics, PH	92.39
1wep_A		79	PHF8; structural genomics, PHD domain, riken struc	92.17
3c6w_A		59	P28ING5, inhibitor of growth protein 5; chromatin,	91.82
1wil_A		89	KIAA1045 protein; ring finger domain, structural g	91.78
1wem_A		76	Death associated transcription factor 1; structura	91.58
2vnf_A		60	ING 4, P29ING4, inhibitor of growth protein 4; ace	90.83
4gne_A		107	Histone-lysine N-methyltransferase NSD3; zinc fing	90.71
3o70_A		68	PHD finger protein 13; PHF13, structural genomics	90.56
1weu_A		91	Inhibitor of growth family, member 4; structural g	90.53
1wen_A		71	Inhibitor of growth family, member 4; ING1-like pr	90.52
4bbq_A		117	Lysine-specific demethylase 2A; oxidoreductase, ub	90.45
2jmi_A		90	Protein YNG1, ING1 homolog 1; PHD, histone, recogn	90.4
2puy_A		60	PHD finger protein 21A; PHD finger, histone CODE,	89.66
2k16_A		75	Transcription initiation factor TFIID subunit 3; p	89.51
2yql_A		56	PHD finger protein 21A; PHD domain, structural gen	89.46
2lv9_A		98	Histone-lysine N-methyltransferase MLL5; zinc fing	89.39
2lri_C		66	Autoimmune regulator; Zn binding protein domain, a	88.93
2l5u_A		61	Chromodomain-helicase-DNA-binding protein 4; CHD4,	88.92
1xwh_A		66	Autoimmune regulator; PHD domain, Zn binding domai	88.92
2zet_C		153	Melanophilin; complex, GTP-binding protein, GTPase	88.8
2ri7_A		174	Nucleosome-remodeling factor subunit BPTF; zinc fi	88.45
2kgg_A		52	Histone demethylase jarid1A; PHD finger, histone m	88.35
1mm2_A		61	MI2-beta; PHD, zinc finger, protein scaffold, DNA	88.23
2xb1_A		105	Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro;	87.26
3kqi_A		75	GRC5, PHD finger protein 2; metal-binding, zinc-fi	87.05
1f62_A		51	Transcription factor WSTF; Zn-finger; NMR {Homo sa	86.4
2vpb_A		65	Hpygo1, pygopus homolog 1; gene regulation, WNT si	85.8
3o7a_A		52	PHD finger protein 13 variant; PHF13, zinc finger,	85.54
4bbq_A		117	Lysine-specific demethylase 2A; oxidoreductase, ub	84.2
2yt5_A		66	Metal-response element-binding transcription facto	83.9
3asl_A		70	E3 ubiquitin-protein ligase UHRF1; histone reader	83.06
1zbd_B		134	Rabphilin-3A; G protein, effector, RABCDR, synapti	82.79
1x4i_A		70	Inhibitor of growth protein 3; structural genomics	82.32
1v5n_A		89	PDI-like hypothetical protein AT1G60420; DC1 domai	82.2
1fp0_A		88	KAP-1 corepressor; PHD domain, C3HC4 type zinc bin	81.73
2e6s_A		77	E3 ubiquitin-protein ligase UHRF2; PHD domain, str	81.19
2ku3_A		71	Bromodomain-containing protein 1; PHD finger, chro	81.05
1wev_A		88	Riken cDNA 1110020M19; structural genomics, PHD do	80.73

>2lq6_A Bromodomain-containing protein 1; PHD finger, metal binding protein; NMR {Homo sapiens}	Back alignment and structure

Probab=99.63  E-value=2.2e-16  Score=133.32  Aligned_cols=72  Identities=42%  Similarity=0.795  Sum_probs=59.6

Q ss_pred             CCcccccccccccccCCC-CCceeecCCCCCCceeeccchhccCCeEEEEeecccc----CCCceEEEcCCCCCCCC
Q psy5645         439 SSIPQSRWALICILCRER-LGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDENA----EDGVKLRSYCQKHSLTT  510 (525)
Q Consensus       439 ~~I~~~r~~l~C~iC~~~-~GacIqCs~~~C~~aFHvtCA~~aGl~m~~~~~~~~~----~d~~~~~~yC~kHs~~~  510 (525)
                      -+||++||+++|++|+++ .||||||+..+|.++||++||+++|+.|++.......    .+.+++.+||++|+|..
T Consensus         9 ~NIp~~R~~l~C~iC~~~~~GAciqC~~~~C~~~fHv~CA~~aGl~~~~~~~~~~~~~~~~~~v~~~~yC~~HsPpg   85 (87)
T 2lq6_A            9 MNIPPARWKLTCYLCKQKGVGASIQCHKANCYTAFHVTCAQKAGLYMKMEPVKELTGGGTTFSVRKTAYCDVHTPPG   85 (87)
T ss_dssp             CCCCCCCCCCCBTTTTBCCSSCEEECSCTTTCCEEEHHHHHHHTCCEEEEEEEECTTTSCEEEEEEEECCGGGSSSS
T ss_pred             cCCChHHhcCCCcCCCCCCCcEeEecCCCCCCCcCcHHHHHHCCCceEeecccccccCCccccceECeECcCCCCcC
Confidence            478999999999999987 5999999999999999999999999999865432211    12357889999999853

PyMOL of 2lq6

>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens}	Back alignment and structure

>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens}	Back alignment and structure

>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2	Back alignment and structure

>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus}	Back alignment and structure

>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2	Back alignment and structure

>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens}	Back alignment and structure

>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A*	Back alignment and structure

>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A*	Back alignment and structure

>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A	Back alignment and structure

>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A	Back alignment and structure

>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A	Back alignment and structure

>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens}	Back alignment and structure

>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens}	Back alignment and structure

>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2	Back alignment and structure

>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A*	Back alignment and structure

>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B	Back alignment and structure

>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A	Back alignment and structure

>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A*	Back alignment and structure

>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens}	Back alignment and structure

>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus}	Back alignment and structure

>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A*	Back alignment and structure

>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A	Back alignment and structure

>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A*	Back alignment and structure

>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A*	Back alignment and structure

>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2	Back alignment and structure

>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A*	Back alignment and structure

>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A	Back alignment and structure

>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens}	Back alignment and structure

>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens}	Back alignment and structure

>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens}	Back alignment and structure

>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens}	Back alignment and structure

>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens}	Back alignment and structure

>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2	Back alignment and structure

>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group}	Back alignment and structure

>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2	Back alignment and structure

>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2	Back alignment and structure

>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A*	Back alignment and structure

>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2	Back alignment and structure

>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens}	Back alignment and structure

>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A*	Back alignment and structure

>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A*	Back alignment and structure

>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A	Back alignment and structure

>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2	Back alignment and structure

>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens}	Back alignment and structure

>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A	Back alignment and structure

>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2	Back alignment and structure

>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A	Back alignment and structure

>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A*	Back alignment and structure

>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2	Back alignment and structure

>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens}	Back alignment and structure

>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A*	Back alignment and structure

>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2	Back alignment and structure

>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group}	Back alignment and structure

>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus}	Back alignment and structure

>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2	Back alignment and structure

>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2	Back alignment and structure

>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A*	Back alignment and structure

>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3	Back alignment and structure

>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2	Back alignment and structure

>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A*	Back alignment and structure

>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A*	Back alignment and structure

>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens}	Back alignment and structure

>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2	Back alignment and structure

>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A	Back alignment and structure

>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens}	Back alignment and structure

>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A*	Back alignment and structure

>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens}	Back alignment and structure

>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A*	Back alignment and structure

>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens}	Back alignment and structure

>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens}	Back alignment and structure

>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A	Back alignment and structure

>2zet_C Melanophilin; complex, GTP-binding protein, GTPase, G-protein, RAB, RAB27B, effector, SLP homology domain, acetylation, lipoprotein, membrane; HET: GTP; 3.00A {Mus musculus}	Back alignment and structure

>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A*	Back alignment and structure

>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A*	Back alignment and structure

>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A	Back alignment and structure

>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens}	Back alignment and structure

>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2	Back alignment and structure

>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2	Back alignment and structure

>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A*	Back alignment and structure

>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens}	Back alignment and structure

>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens}	Back alignment and structure

>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus}	Back alignment and structure

>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B	Back alignment and structure

>1zbd_B Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: g.50.1.1	Back alignment and structure

>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3	Back alignment and structure

>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2	Back alignment and structure

>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens}	Back alignment and structure

>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		525
d1z3ix2		298	c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fis	1e-16
d1weva_		88	g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu	1e-11
d1we9a_		64	g.50.1.2 (A:) PHD finger protein At5g26210 {Thale	1e-09
d1weea_		72	g.50.1.2 (A:) PHD finger protein At1g33420 {Thale	2e-09
d1wesa_		71	g.50.1.2 (A:) PHD Inhibitor of growth protein 2, I	6e-09
d1wema_		76	g.50.1.2 (A:) Death associated transcription facto	1e-08
d1fp0a1		70	g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-	1e-08
d1f62a_		51	g.50.1.2 (A:) Williams-Beuren syndrome transcripti	3e-08
d1mm2a_		61	g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens	1e-07
d2pnxa1		51	g.50.1.2 (A:195-245) Inhibitor of growth protein 4	4e-07
d1wewa_		78	g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c	1e-06
d1wepa_		79	g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus	5e-05

>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 298	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Rad54-like, Rad54L
species: Zebra fish (Danio rerio) [TaxId: 7955]

 Score = 78.2 bits (191), Expect = 1e-16
 Identities = 38/55 (69%), Positives = 44/55 (80%)

Query: 37 LGVRREGARKALHDPTAPNALVLYTPPQLSAHDLLKIDKDKIQVHVVVDPVLSNI 91
          LG+RR G RKALHDP    ALVLY PP +SAHDL+K DK+K+ VHVVVDPVLS +
Sbjct: 1  LGLRRAGVRKALHDPFEDGALVLYEPPAISAHDLIKADKEKLPVHVVVDPVLSKV 55

PyMOL of d1z3ix2

>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88	Back information, alignment and structure

>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64	Back information, alignment and structure

>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72	Back information, alignment and structure

>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 71	Back information, alignment and structure

>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76	Back information, alignment and structure

>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70	Back information, alignment and structure

>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51	Back information, alignment and structure

>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61	Back information, alignment and structure

>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51	Back information, alignment and structure

>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78	Back information, alignment and structure

>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		525
d1weva_		88	PHD finger protein 22 {Mouse (Mus musculus) [TaxId	98.72
d1fp0a1		70	Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo	98.55
d1z3ix2		298	Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI	98.54
d1f62a_		51	Williams-Beuren syndrome transcription factor, WST	98.54
d1mm2a_		61	Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606	98.41
d1wesa_		71	PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu	98.35
d2pnxa1		51	Inhibitor of growth protein 4, Ing4 {Homo sapiens	98.12
d1we9a_		64	PHD finger protein At5g26210 {Thale cress (Arabido	98.09
d1weea_		72	PHD finger protein At1g33420 {Thale cress (Arabido	97.87
d1wema_		76	Death associated transcription factor 1, Datf1 (DI	97.55
d1wewa_		78	Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop	97.52
d1wepa_		79	PHD finger protein 8 {Mouse (Mus musculus) [TaxId:	97.43
d1mm2a_		61	Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606	93.7
d1zbdb_		124	Effector domain of rabphilin-3a {Rat (Rattus norve	92.65
d1vyxa_		60	IE1B protein (ORF K3), N-terminal domain {Kaposi's	91.74
d1weea_		72	PHD finger protein At1g33420 {Thale cress (Arabido	91.58
d1wema_		76	Death associated transcription factor 1, Datf1 (DI	90.93
d1f62a_		51	Williams-Beuren syndrome transcription factor, WST	90.78
d1weva_		88	PHD finger protein 22 {Mouse (Mus musculus) [TaxId	90.54
d1fp0a1		70	Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo	90.42
d1we9a_		64	PHD finger protein At5g26210 {Thale cress (Arabido	88.17
d1wewa_		78	Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop	87.82
d1wepa_		79	PHD finger protein 8 {Mouse (Mus musculus) [TaxId:	85.77
d1iyma_		55	EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45	85.17
d2pnxa1		51	Inhibitor of growth protein 4, Ing4 {Homo sapiens	84.89

>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: PHD finger protein 22
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=98.72  E-value=2.3e-09  Score=87.89  Aligned_cols=55  Identities=29%  Similarity=0.642  Sum_probs=46.6

Q ss_pred             cccCcccccccCCCCCCCCCcEEEccCCCceecccccccc------ccCCCCccceeecCC
Q psy5645         334 EFDENVICDVCRSPDSEEGNEMVFCDCCNICVHQACYGIT------TIPSGSWLCRTCVLG  388 (525)
Q Consensus       334 e~ded~~C~VC~~~e~ed~N~lv~CD~C~i~VHq~CYgi~------~iPeg~WlC~~C~~~  388 (525)
                      +.+.+..|.||+.....+.+.||+||+|+..||+.|+++.      .+|++.|+|..|...
T Consensus        12 ~~~~~~~C~iC~~~~~~~~~~~v~Cd~C~~~~H~~C~~p~~~~~~~~~~~~~W~C~~C~~~   72 (88)
T d1weva_          12 AMEMGLACVVCRQMTVASGNQLVECQECHNLYHQDCHKPQVTDKEVNDPRLVWYCARCTRQ   72 (88)
T ss_dssp             HHHHCCSCSSSCCCCCCTTCCEEECSSSCCEEETTTSSSCCCHHHHHCTTCCCCCHHHHHH
T ss_pred             cCcCcCCccCCCCccCCCCCeEEEcCCCCCccccccCCCcccccccccCCCeEECcccCch
Confidence            3455678999998877778899999999999999999964      367889999999864

PyMOL of d1weva_

>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]}	Back information, alignment and structure

>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]}	Back information, alignment and structure

>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]}	Back information, alignment and structure

>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]}	Back information, alignment and structure