Diaphorina citri psyllid: psy5646

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100------
MGKLYKDEDAVLSWNGHGTKGSQAIVKYISELPPCDHELKSMDIHRLPEEAAQNQIAYLISTSGTVVYKNMKKTGFNQNFIISAEGARWKIISDVFRLQQTPVNMT
ccccccccccEEEEcccccccHHHHHHHHHccccCEEEEEEEEEECccccccccccEEEEEEEEEEEEccccccccEEEEEEEEEccEEEEEEcEEEccccccccc
MGKLYKDEDAVLSWNGHGTKGSQAIVKYISELPPCDHELKSMDIHRLPEEAAQNQIAYLISTSGTVVYKNMKKTGFNQNFIISAEGARWKIISDVFRLQQTPV***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKLYKDEDAVLSWNGHGTKGSQAIVKYISELPPCDHELKSMDIHRLPEEAAQNQIAYLISTSGTVVYKNMKKTGFNQNFIISAEGARWKIISDVFRLQQTPVNMT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NTF2-related export protein 2 Regulator of protein export for NES-containing proteins. Also plays a role in mRNA nuclear export.confidentQ9NPJ8
NTF2-related export protein 2 Regulator of protein export for NES-containing proteins. Also plays a role in mRNA nuclear export.confidentQ3UNA4
NTF2-related export protein Stimulator of protein export for NES-containing proteins. Also plays a role in the nuclear export of U1 snRNA, tRNA, and mRNA.confidentQ9V3H8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006611 [BP]protein export from nucleusprobableGO:0051169, GO:0051168, GO:0016482, GO:0008104, GO:0044699, GO:0070727, GO:0006886, GO:0071702, GO:0033036, GO:0034613, GO:0006810, GO:0006913, GO:0045184, GO:0044765, GO:0044763, GO:0051649, GO:0051234, GO:0051179, GO:0051641, GO:0046907, GO:0015031, GO:0008150, GO:0009987
GO:0008536 [MF]Ran GTPase bindingprobableGO:0019899, GO:0017016, GO:0031267, GO:0051020, GO:0003674, GO:0005488, GO:0005515
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005643 [CC]nuclear poreprobableGO:0005635, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0031224, GO:0044446, GO:0046930, GO:0016021, GO:0016020, GO:0031967, GO:0012505, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044428, GO:0044424, GO:0044425, GO:0005634, GO:0044422
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0006405 [BP]RNA export from nucleusprobableGO:0015931, GO:0051169, GO:0051168, GO:0016482, GO:0044699, GO:0071705, GO:0071702, GO:0033036, GO:0009987, GO:0006810, GO:0006913, GO:0044763, GO:0051649, GO:0051236, GO:0051234, GO:0051179, GO:0051641, GO:0050658, GO:0006403, GO:0046907, GO:0050657, GO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JKG, chain A
Confidence level:very confident
Coverage over the Query: 1-102
View the alignment between query and template
View the model in PyMOL