Psyllid ID: psy5646


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100------
MGKLYKDEDAVLSWNGHGTKGSQAIVKYISELPPCDHELKSMDIHRLPEEAAQNQIAYLISTSGTVVYKNMKKTGFNQNFIISAEGARWKIISDVFRLQQTPVNMT
ccccccccccEEEEcccccccHHHHHHHHHccccEEEEEEEEEEEEccccccccccEEEEEEEEEEEEccccccccEEEEEEEEEccEEEEEEcEEEccccccccc
cccEEEccccEEEEcccccccHHHHHHHHHccccccEEEEEEEcccccccccccccEEEEEEEEEEEEcccccccEEEEEEEEcccccEEEEccEEEEEccccccc
mgklykdedavlswnghgtkgSQAIVKYIselppcdhelksmdihrlpeEAAQNQIAYLISTSGTVVYknmkktgfnqNFIISAEGARWKIISDVFrlqqtpvnmt
MGKLYKDEDAVLswnghgtkgsQAIVKYISELPPCDHELKSMDIHRLPEEAAQNQIAYLISTSGTVVYKNMKKTGFNQNFIISAEGARWKIISDvfrlqqtpvnmt
MGKLYKDEDAVLSWNGHGTKGSQAIVKYISELPPCDHELKSMDIHRLPEEAAQNQIAYLISTSGTVVYKNMKKTGFNQNFIISAEGARWKIISDVFRLQQTPVNMT
**********VLSWNGHGTKGSQAIVKYISELPPCDHELKSMDIHRLPEEAAQNQIAYLISTSGTVVYKNMKKTGFNQNFIISAEGARWKIISDVFRL********
MGKLYKDEDAVLSWNGHGTKGSQAIVKYISELPPCDHELKSMDIHRLPEEAAQNQIAYLISTSGTVVYKNMKKTGFNQNFIISAEGARWKIISDVFRLQQTPV***
MGKLYKDEDAVLSWNGHGTKGSQAIVKYISELPPCDHELKSMDIHRLPEEAAQNQIAYLISTSGTVVYKNMKKTGFNQNFIISAEGARWKIISDVFRLQQTPVNMT
*GKLYKDEDAVLSWNGHGTKGSQAIVKYISELPPCDHELKSMDIHRLPEEAAQNQIAYLISTSGTVVYKNMKKTGFNQNFIISAEGARWKIISDVFRLQQTP****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKLYKDEDAVLSWNGHGTKGSQAIVKYISELPPCDHELKSMDIHRLPEEAAQNQIAYLISTSGTVVYKNMKKTGFNQNFIISAEGARWKIISDVFRLQQTPVNMT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query106 2.2.26 [Sep-21-2011]
Q9V3H8133 NTF2-related export prote yes N/A 0.933 0.744 0.43 5e-21
Q5ZLH0141 NTF2-related export prote yes N/A 0.924 0.695 0.359 4e-14
Q9NPJ8142 NTF2-related export prote yes N/A 0.924 0.690 0.368 7e-14
A6QNX3142 NTF2-related export prote yes N/A 0.924 0.690 0.368 9e-14
Q3UNA4142 NTF2-related export prote yes N/A 0.924 0.690 0.359 7e-13
B2GV77142 NTF2-related export prote yes N/A 0.905 0.676 0.366 8e-13
Q2KIW0140 NTF2-related export prote no N/A 0.924 0.7 0.330 4e-12
Q9QZV9140 NTF2-related export prote no N/A 0.924 0.7 0.320 9e-12
Q9UKK6140 NTF2-related export prote no N/A 0.924 0.7 0.320 1e-11
Q9U757137 NTF2-related export prote yes N/A 0.792 0.613 0.305 1e-08
>sp|Q9V3H8|NXT1_DROME NTF2-related export protein OS=Drosophila melanogaster GN=Nxt1 PE=2 SV=1 Back     alignment and function desciption
 Score = 99.8 bits (247), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 67/100 (67%), Gaps = 1/100 (1%)

Query: 1   MGKLYKDEDAVLSWNGHGTKGSQAIVKYISELPPCDHELKSMDIHRLPEEAAQNQIAYLI 60
           +G+LY D +A LSWNG+G  G Q I  Y  ELP  +H+L ++D   + ++A  NQ+AYLI
Sbjct: 34  IGRLYLD-NATLSWNGNGAIGRQMIESYFQELPSSNHQLNTLDAQPIVDQAVSNQLAYLI 92

Query: 61  STSGTVVYKNMKKTGFNQNFIISAEGARWKIISDVFRLQQ 100
             SG+V + + +   F Q FI++AE  +WK++SD +R+Q+
Sbjct: 93  MASGSVKFADQQLRKFQQTFIVTAENDKWKVVSDCYRMQE 132




Stimulator of protein export for NES-containing proteins. Also plays a role in the nuclear export of U1 snRNA, tRNA, and mRNA.
Drosophila melanogaster (taxid: 7227)
>sp|Q5ZLH0|NXT2_CHICK NTF2-related export protein 2 OS=Gallus gallus GN=NXT2 PE=2 SV=1 Back     alignment and function description
>sp|Q9NPJ8|NXT2_HUMAN NTF2-related export protein 2 OS=Homo sapiens GN=NXT2 PE=2 SV=1 Back     alignment and function description
>sp|A6QNX3|NXT2_BOVIN NTF2-related export protein 2 OS=Bos taurus GN=NXT2 PE=2 SV=1 Back     alignment and function description
>sp|Q3UNA4|NXT2_MOUSE NTF2-related export protein 2 OS=Mus musculus GN=Nxt2 PE=2 SV=1 Back     alignment and function description
>sp|B2GV77|NXT2_RAT NTF2-related export protein 2 OS=Rattus norvegicus GN=Nxt2 PE=2 SV=1 Back     alignment and function description
>sp|Q2KIW0|NXT1_BOVIN NTF2-related export protein 1 OS=Bos taurus GN=NXT1 PE=2 SV=1 Back     alignment and function description
>sp|Q9QZV9|NXT1_MOUSE NTF2-related export protein 1 OS=Mus musculus GN=Nxt1 PE=1 SV=2 Back     alignment and function description
>sp|Q9UKK6|NXT1_HUMAN NTF2-related export protein 1 OS=Homo sapiens GN=NXT1 PE=1 SV=1 Back     alignment and function description
>sp|Q9U757|NXT1_CAEEL NTF2-related export protein OS=Caenorhabditis elegans GN=nxt-1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query106
195347206133 GM15511 [Drosophila sechellia] gi|195586 0.933 0.744 0.44 2e-19
19922840133 NTF2-related export protein 1 [Drosophil 0.933 0.744 0.43 2e-19
125806589135 GA11789 [Drosophila pseudoobscura pseudo 0.962 0.755 0.427 1e-18
189235963 292 PREDICTED: similar to p15-2a protein [Tr 0.971 0.352 0.423 1e-18
270003253142 hypothetical protein TcasGA2_TC002461 [T 0.971 0.725 0.423 1e-18
194752693135 GF12459 [Drosophila ananassae] gi|190619 0.962 0.755 0.427 2e-18
194885630133 GG19997 [Drosophila erecta] gi|190659654 0.933 0.744 0.44 3e-18
38047919132 similar to Drosophila melanogaster Nxt1, 0.933 0.75 0.43 1e-17
195489313133 Nxt1 [Drosophila yakuba] gi|194178784|gb 0.933 0.744 0.43 1e-17
195133480135 GI16389 [Drosophila mojavensis] gi|19390 0.962 0.755 0.432 3e-17
>gi|195347206|ref|XP_002040145.1| GM15511 [Drosophila sechellia] gi|195586166|ref|XP_002082849.1| GD25012 [Drosophila simulans] gi|194135494|gb|EDW57010.1| GM15511 [Drosophila sechellia] gi|194194858|gb|EDX08434.1| GD25012 [Drosophila simulans] Back     alignment and taxonomy information
 Score = 99.8 bits (247), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 65/100 (65%), Gaps = 1/100 (1%)

Query: 1   MGKLYKDEDAVLSWNGHGTKGSQAIVKYISELPPCDHELKSMDIHRLPEEAAQNQIAYLI 60
           +G+LY D +A LSWNG+G  G Q I  Y  ELP   H+L ++D   + ++A  NQ+AYLI
Sbjct: 34  IGRLYLD-NATLSWNGNGATGRQMIESYFRELPSSKHQLNTLDAQPIVDQAVSNQLAYLI 92

Query: 61  STSGTVVYKNMKKTGFNQNFIISAEGARWKIISDVFRLQQ 100
             SG+V + +     F Q FI++AE  +WK++SD +RLQ+
Sbjct: 93  MASGSVKFSDQPLRKFQQTFIVTAENEKWKVVSDCYRLQE 132




Source: Drosophila sechellia

Species: Drosophila sechellia

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|19922840|ref|NP_611833.1| NTF2-related export protein 1 [Drosophila melanogaster] gi|18203549|sp|Q9V3H8.1|NXT1_DROME RecName: Full=NTF2-related export protein; AltName: Full=p15 gi|5880869|gb|AAD54944.1|AF156959_1 NTF2-related export protein NXT1 [Drosophila melanogaster] gi|7291644|gb|AAF47066.1| NTF2-related export protein 1 [Drosophila melanogaster] gi|17945644|gb|AAL48872.1| RE28995p [Drosophila melanogaster] gi|220948300|gb|ACL86693.1| Nxt1-PA [synthetic construct] Back     alignment and taxonomy information
>gi|125806589|ref|XP_001357529.1| GA11789 [Drosophila pseudoobscura pseudoobscura] gi|195148928|ref|XP_002015414.1| GL11070 [Drosophila persimilis] gi|54635250|gb|EAL24653.1| GA11789 [Drosophila pseudoobscura pseudoobscura] gi|194109261|gb|EDW31304.1| GL11070 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|189235963|ref|XP_969322.2| PREDICTED: similar to p15-2a protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270003253|gb|EEZ99700.1| hypothetical protein TcasGA2_TC002461 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|194752693|ref|XP_001958654.1| GF12459 [Drosophila ananassae] gi|190619952|gb|EDV35476.1| GF12459 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|194885630|ref|XP_001976467.1| GG19997 [Drosophila erecta] gi|190659654|gb|EDV56867.1| GG19997 [Drosophila erecta] Back     alignment and taxonomy information
>gi|38047919|gb|AAR09862.1| similar to Drosophila melanogaster Nxt1, partial [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195489313|ref|XP_002092683.1| Nxt1 [Drosophila yakuba] gi|194178784|gb|EDW92395.1| Nxt1 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195133480|ref|XP_002011167.1| GI16389 [Drosophila mojavensis] gi|193907142|gb|EDW06009.1| GI16389 [Drosophila mojavensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query106
FB|FBgn0028411133 Nxt1 "NTF2-related export prot 0.933 0.744 0.43 2.1e-20
UNIPROTKB|F1ND17136 NXT2 "NTF2-related export prot 0.905 0.705 0.366 7.9e-14
UNIPROTKB|Q5ZLH0141 NXT2 "NTF2-related export prot 0.905 0.680 0.366 7.9e-14
UNIPROTKB|Q9NPJ8142 NXT2 "NTF2-related export prot 0.905 0.676 0.376 7.9e-14
UNIPROTKB|A6QNX3142 NXT2 "NTF2-related export prot 0.905 0.676 0.376 1e-13
UNIPROTKB|K7GMM6114 LOC100521422 "Uncharacterized 0.905 0.842 0.376 1.6e-13
UNIPROTKB|K7GNP4142 LOC100521422 "Uncharacterized 0.905 0.676 0.376 1.6e-13
UNIPROTKB|F1RWU7144 LOC100521422 "Uncharacterized 0.905 0.666 0.378 2.7e-13
ZFIN|ZDB-GENE-050521-1143 nxt2 "nuclear transport factor 0.905 0.671 0.339 2.7e-13
RGD|1560204142 Nxt2 "nuclear transport factor 0.905 0.676 0.366 4.4e-13
FB|FBgn0028411 Nxt1 "NTF2-related export protein 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 241 (89.9 bits), Expect = 2.1e-20, P = 2.1e-20
 Identities = 43/100 (43%), Positives = 67/100 (67%)

Query:     1 MGKLYKDEDAVLSWNGHGTKGSQAIVKYISELPPCDHELKSMDIHRLPEEAAQNQIAYLI 60
             +G+LY D +A LSWNG+G  G Q I  Y  ELP  +H+L ++D   + ++A  NQ+AYLI
Sbjct:    34 IGRLYLD-NATLSWNGNGAIGRQMIESYFQELPSSNHQLNTLDAQPIVDQAVSNQLAYLI 92

Query:    61 STSGTVVYKNMKKTGFNQNFIISAEGARWKIISDVFRLQQ 100
               SG+V + + +   F Q FI++AE  +WK++SD +R+Q+
Sbjct:    93 MASGSVKFADQQLRKFQQTFIVTAENDKWKVVSDCYRMQE 132




GO:0006611 "protein export from nucleus" evidence=NAS
GO:0005634 "nucleus" evidence=NAS
GO:0006408 "snRNA export from nucleus" evidence=NAS
GO:0006406 "mRNA export from nucleus" evidence=NAS
GO:0006409 "tRNA export from nucleus" evidence=NAS
GO:0005635 "nuclear envelope" evidence=IDA
GO:0016973 "poly(A)+ mRNA export from nucleus" evidence=IMP
GO:0005737 "cytoplasm" evidence=IDA
GO:0005654 "nucleoplasm" evidence=IDA
UNIPROTKB|F1ND17 NXT2 "NTF2-related export protein 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZLH0 NXT2 "NTF2-related export protein 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NPJ8 NXT2 "NTF2-related export protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A6QNX3 NXT2 "NTF2-related export protein 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|K7GMM6 LOC100521422 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|K7GNP4 LOC100521422 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1RWU7 LOC100521422 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050521-1 nxt2 "nuclear transport factor 2-like export factor 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1560204 Nxt2 "nuclear transport factor 2-like export factor 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9NPJ8NXT2_HUMANNo assigned EC number0.36890.92450.6901yesN/A
Q3UNA4NXT2_MOUSENo assigned EC number0.35920.92450.6901yesN/A
Q9V3H8NXT1_DROMENo assigned EC number0.430.93390.7443yesN/A
A6QNX3NXT2_BOVINNo assigned EC number0.36890.92450.6901yesN/A
Q5ZLH0NXT2_CHICKNo assigned EC number0.35920.92450.6950yesN/A
Q9U757NXT1_CAEELNo assigned EC number0.30580.79240.6131yesN/A
B2GV77NXT2_RATNo assigned EC number0.36630.90560.6760yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.3.3.1LOW CONFIDENCE prediction!
3rd Layer5.3.3LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query106
cd00780119 cd00780, NTF2, Nuclear transport factor 2 (NTF2) d 2e-14
pfam02136116 pfam02136, NTF2, Nuclear transport factor 2 (NTF2) 4e-10
>gnl|CDD|238403 cd00780, NTF2, Nuclear transport factor 2 (NTF2) domain plays an important role in the trafficking of macromolecules, ions and small molecules between the cytoplasm and nucleus Back     alignment and domain information
 Score = 63.5 bits (155), Expect = 2e-14
 Identities = 23/102 (22%), Positives = 48/102 (47%), Gaps = 10/102 (9%)

Query: 1   MGKLYKDEDAVLSWNG-HGTKGSQAIVKYISELPP--CDHELKSMDIHRLPEEAAQNQIA 57
           + +LY D  ++LS  G     G  AIV+ +S LP     H++ ++D    P         
Sbjct: 24  LHRLYGDT-SMLSREGMKQVTGRDAIVEKLSSLPFQKTKHKITTVDSQPTPSGG------ 76

Query: 58  YLISTSGTVVYKNMKKTGFNQNFIISAEGARWKIISDVFRLQ 99
            ++  +G++         F+Q F+++ +   + +++D+FR  
Sbjct: 77  VIVMVTGSLKLDEQPPRKFSQTFVLAPQNGGYFVLNDIFRFV 118


This bi-directional transport of macromolecules across the nuclear envelope requires many soluble factors that includes GDP-binding protein Ran (RanGDP). RanGDP is required for both import and export of proteins and poly(A) RNA. RanGDP also has been implicated in cell cycle control, specifically in mitotic spindle assembly. In interphase cells, RanGDP is predominately nuclear and thought to be GTP bound, but it is also present in the cytoplasm, probably in the GDP-bound state. NTF2 mediates the nuclear import of RanGDP. NTF2 binds to both RanGDP and FxFG repeat-containing nucleoporins. Length = 119

>gnl|CDD|216894 pfam02136, NTF2, Nuclear transport factor 2 (NTF2) domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 106
KOG4353|consensus139 100.0
KOG2104|consensus126 99.98
cd00780119 NTF2 Nuclear transport factor 2 (NTF2) domain play 99.97
PF02136118 NTF2: Nuclear transport factor 2 (NTF2) domain; In 99.93
KOG0116|consensus 419 99.91
PF10429166 Mtr2: Nuclear pore RNA shuttling protein Mtr2; Int 99.49
cd00531124 NTF2_like Nuclear transport factor 2 (NTF2-like) s 98.61
KOG3763|consensus585 97.98
PF13474121 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE 97.45
PF14534107 DUF4440: Domain of unknown function (DUF4440); PDB 97.17
TIGR02246128 conserved hypothetical protein. This family consis 97.01
PF15008262 DUF4518: Domain of unknown function (DUF4518) 94.63
PF08332128 CaMKII_AD: Calcium/calmodulin dependent protein ki 94.55
PF12893116 Lumazine_bd_2: Putative lumazine-binding; PDB: 3BL 93.9
PF13577127 SnoaL_4: SnoaL-like domain; PDB: 3S5C_B 3EJV_A 2RF 93.47
COG4319137 Ketosteroid isomerase homolog [Function unknown] 93.05
PF12680102 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8 91.39
>KOG4353|consensus Back     alignment and domain information
Probab=100.00  E-value=4.2e-34  Score=187.08  Aligned_cols=102  Identities=32%  Similarity=0.654  Sum_probs=97.4

Q ss_pred             CCCCCCCCCceEEEcCCccccHHHHHHHHHcCCCeeEEEeEEEEEeCCcccccCceeEEEEEEEEEEECCceeeeeeEEE
Q psy5646           1 MGKLYKDEDAVLSWNGHGTKGSQAIVKYISELPPCDHELKSMDIHRLPEEAAQNQIAYLISTSGTVVYKNMKKTGFNQNF   80 (106)
Q Consensus         1 l~~~Y~~~~s~l~~nG~~~~G~~~I~~~l~~lp~~~h~i~s~D~q~~~~~~~~~~~~ili~V~G~v~~~~~~~~~F~qtF   80 (106)
                      |++||.+ +|.++|||+++.|++.|.+++..||.++|+|+++||||+++.+++++.++||+|+|.|+++|+++|.|.|||
T Consensus        34 i~rlY~~-~atlvWNGn~v~g~esls~ff~~LPsS~~qi~~lD~Qpv~dqat~~q~~vLvvvsGtVkFdG~k~r~F~qt~  112 (139)
T KOG4353|consen   34 IGRLYLD-NATLVWNGNPVSGTESLSEFFNMLPSSEFQINDLDCQPVHDQATGSQTTVLVVVSGTVKFDGNKQRVFNQTF  112 (139)
T ss_pred             hHHHhhc-cceEEEcCCcchhHHHHHHHHHhCCCccccccccccccchhhcccccceEEEEEeeeEEEcCCcccccccee
Confidence            5789999 999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEeCCeEE----EEceeEEeeecCC
Q psy5646          81 IISAEGARWK----IISDVFRLQQTPV  103 (106)
Q Consensus        81 vL~~~~~~y~----I~nD~fR~~~~~~  103 (106)
                      +|.++++.|.    |.+||||++|+.+
T Consensus       113 ll~~e~~~~k~~~~v~Sd~fr~~d~~~  139 (139)
T KOG4353|consen  113 LLTAEDPPFKTVWKVASDCFRFQDWQS  139 (139)
T ss_pred             EEeecCCccchhhhhhhhhhhhhhccC
Confidence            9999987666    9999999999864



>KOG2104|consensus Back     alignment and domain information
>cd00780 NTF2 Nuclear transport factor 2 (NTF2) domain plays an important role in the trafficking of macromolecules, ions and small molecules between the cytoplasm and nucleus Back     alignment and domain information
>PF02136 NTF2: Nuclear transport factor 2 (NTF2) domain; InterPro: IPR002075 Nuclear transport factor 2 (NTF2) is a homodimer which stimulates efficient nuclear import of a cargo protein Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>PF10429 Mtr2: Nuclear pore RNA shuttling protein Mtr2; InterPro: IPR019488 Mtr2 is a monomeric, dual-action, RNA-shuttle protein found in yeasts Back     alignment and domain information
>cd00531 NTF2_like Nuclear transport factor 2 (NTF2-like) superfamily Back     alignment and domain information
>KOG3763|consensus Back     alignment and domain information
>PF13474 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE7_A 3BB9_E 3CNX_A 3F7S_A 3GWR_B Back     alignment and domain information
>PF14534 DUF4440: Domain of unknown function (DUF4440); PDB: 3HX8_A 3SOY_A 3ROB_B 3GZR_A 3B7C_A 3CU3_A 3FSD_A 2R4I_C 1TP6_A Back     alignment and domain information
>TIGR02246 conserved hypothetical protein Back     alignment and domain information
>PF15008 DUF4518: Domain of unknown function (DUF4518) Back     alignment and domain information
>PF08332 CaMKII_AD: Calcium/calmodulin dependent protein kinase II Association; InterPro: IPR013543 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PF12893 Lumazine_bd_2: Putative lumazine-binding; PDB: 3BLZ_C 3DUK_F 3FKA_C Back     alignment and domain information
>PF13577 SnoaL_4: SnoaL-like domain; PDB: 3S5C_B 3EJV_A 2RFR_A 3B8L_F 2CHC_A 3A76_A 3EF8_B Back     alignment and domain information
>COG4319 Ketosteroid isomerase homolog [Function unknown] Back     alignment and domain information
>PF12680 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8Z_A 3DMC_A 3FH1_A 1TUH_A 3F14_A 3ER7_A 1Z1S_A 3F7X_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query106
1jkg_A140 Structural Basis For The Recognition Of A Nucleopor 8e-13
3nv0_B154 Crystal Structure And Mutational Analysis Of The Nx 9e-10
1jb2_A127 Crystal Structure Of Ntf2 M84e Mutant Length = 127 6e-04
1jb4_A127 Crystal Structure Of Ntf2 M102e Mutant Length = 127 7e-04
>pdb|1JKG|A Chain A, Structural Basis For The Recognition Of A Nucleoporin Fg- Repeat By The Ntf2-Like Domain Of Tap-P15 Mrna Nuclear Export Factor Length = 140 Back     alignment and structure

Iteration: 1

Score = 68.6 bits (166), Expect = 8e-13, Method: Compositional matrix adjust. Identities = 33/103 (32%), Positives = 57/103 (55%), Gaps = 5/103 (4%) Query: 1 MGKLYKDEDAVLSWNGHGTKGSQAIVKYISELPPCDHELKSMDIHRLPEEAAQNQIAYLI 60 + +LY A L WNG+ G +++ ++ LP + ++ +D + +EA +Q L+ Sbjct: 35 LSRLYMGT-ATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLV 93 Query: 61 STSGTVVYKNMKKTGFNQNFIISAEGAR----WKIISDVFRLQ 99 G+V ++ K+ FNQNFI++A+ + WKI SD FR Q Sbjct: 94 VICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQ 136
>pdb|3NV0|B Chain B, Crystal Structure And Mutational Analysis Of The Nxf2NXT1 Heterodimeric Complex From Caenorhabditis Elegans At 1.84 A Resolution Length = 154 Back     alignment and structure
>pdb|1JB2|A Chain A, Crystal Structure Of Ntf2 M84e Mutant Length = 127 Back     alignment and structure
>pdb|1JB4|A Chain A, Crystal Structure Of Ntf2 M102e Mutant Length = 127 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query106
1jkg_A140 P15; NTF2-like domain, transport protein; 1.90A {H 4e-21
3nv0_B154 NTF2-related export protein; NTF2-like domain, bet 4e-20
1gy6_A127 Nuclear transport factor 2; 1.6A {Rattus norvegicu 2e-15
1gy7_A125 Nuclear transport factor 2; protein transport; 1.6 6e-13
3ujm_A120 Rasputin; NTF2-like fold, RAS signaling, signaling 2e-12
1zo2_A129 NTF2, nuclear transport factor 2; structural genom 4e-12
3q90_A140 RAS GTPase-activating protein-binding protein 1; s 3e-08
2qiy_A154 UBP3-associated protein BRE5; deubiquitylation, ub 2e-06
1jkg_B250 TAP; NTF2-like domain, transport protein; 1.90A {H 7e-05
>1jkg_A P15; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_A Length = 140 Back     alignment and structure
 Score = 80.8 bits (199), Expect = 4e-21
 Identities = 33/103 (32%), Positives = 57/103 (55%), Gaps = 5/103 (4%)

Query: 1   MGKLYKDEDAVLSWNGHGTKGSQAIVKYISELPPCDHELKSMDIHRLPEEAAQNQIAYLI 60
           + +LY    A L WNG+   G +++ ++   LP  + ++  +D   + +EA  +Q   L+
Sbjct: 35  LSRLYMG-TATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLV 93

Query: 61  STSGTVVYKNMKKTGFNQNFIISAEGA----RWKIISDVFRLQ 99
              G+V ++  K+  FNQNFI++A+ +     WKI SD FR Q
Sbjct: 94  VICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQ 136


>3nv0_B NTF2-related export protein; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} Length = 154 Back     alignment and structure
>1gy6_A Nuclear transport factor 2; 1.6A {Rattus norvegicus} SCOP: d.17.4.2 PDB: 1a2k_A 1oun_A 1ar0_A 1u5o_A 1ask_A 1gy5_A 1jb5_A 1jb4_A 1jb2_A 1qma_A Length = 127 Back     alignment and structure
>1gy7_A Nuclear transport factor 2; protein transport; 1.6A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1gyb_A Length = 125 Back     alignment and structure
>3ujm_A Rasputin; NTF2-like fold, RAS signaling, signaling protein; HET: EPE; 2.74A {Drosophila melanogaster} Length = 120 Back     alignment and structure
>1zo2_A NTF2, nuclear transport factor 2; structural genomics, structural genomics consortium, SGC, transport protein; 1.60A {Cryptosporidium parvum} SCOP: d.17.4.2 Length = 129 Back     alignment and structure
>3q90_A RAS GTPase-activating protein-binding protein 1; structural genomics, structural genomics consortium, SGC, NT (A+B proteins); 1.70A {Homo sapiens} Length = 140 Back     alignment and structure
>2qiy_A UBP3-associated protein BRE5; deubiquitylation, ubiquitin-specific processing proteases(UB NTF2, protein-protein recognition; 1.69A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1zx2_A Length = 154 Back     alignment and structure
>1jkg_B TAP; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_B 1go5_A Length = 250 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query106
1gy7_A125 Nuclear transport factor 2; protein transport; 1.6 100.0
3nv0_B154 NTF2-related export protein; NTF2-like domain, bet 100.0
1gy6_A127 Nuclear transport factor 2; 1.6A {Rattus norvegicu 100.0
1jkg_A140 P15; NTF2-like domain, transport protein; 1.90A {H 100.0
1zo2_A129 NTF2, nuclear transport factor 2; structural genom 100.0
3ujm_A120 Rasputin; NTF2-like fold, RAS signaling, signaling 100.0
3q90_A140 RAS GTPase-activating protein-binding protein 1; s 100.0
2qiy_A154 UBP3-associated protein BRE5; deubiquitylation, ub 99.97
1of5_A221 MRNA export factor MEX67; nuclear protein, repeat, 99.91
1jkg_B250 TAP; NTF2-like domain, transport protein; 1.90A {H 99.9
1q40_B219 MEX67, mRNA export factor MEX67; NTF2-fold, nuclea 99.89
1q42_A201 MTR2, mRNA transport regulator MTR2; NTF2-fold, nu 99.83
3nv0_A205 Nuclear RNA export factor 2; NTF2-like domain, bet 99.78
1of5_B184 MTR2, YKL186C, mRNA transport regulator MTR2; nucl 99.66
4i4k_A143 Uncharacterized protein SGCJ; structural genomics, 97.93
3cu3_A172 Domain of unknown function with A cystatin-like F; 97.5
3gzr_A146 Uncharacterized protein with A NTF2-like fold; str 97.47
3hx8_A129 MLR2180 protein, putative ketosteroid isomerase; s 97.12
3d9r_A135 Ketosteroid isomerase-like protein; YP_049581.1, s 96.78
3h51_A156 Putative calcium/calmodulin dependent protein KIN 96.64
3rob_A139 Uncharacterized conserved protein; structural geno 96.43
3gwr_A144 Putative calcium/calmodulin-dependent protein KIN 96.38
2gxf_A142 Hypothetical protein YYBH; alpha-beta protein., st 96.35
2ux0_A143 Calcium-calmodulin dependent protein kinase (CAM I 96.28
3bb9_A148 Putative orphan protein; structural genomics, join 96.15
3b7c_A122 Uncharacterized protein; NTF-2 like protein, struc 95.73
3duk_A125 NTF2-like protein of unknown function; structural 95.49
2chc_A170 Protein RV3472; hypothetical protein; 1.69A {Mycob 95.33
2rfr_A155 Uncharacterized protein; structural genomics, join 95.16
3f7s_A142 Uncharacterized NTF2-like protein; structural geno 95.1
2rcd_A129 Uncharacterized protein; structural genomics, join 94.58
3cnx_A170 Uncharacterized protein; putative dehydratase, NTF 94.26
3mg1_A323 OCP, orange carotenoid protein; carotenoid binding 93.87
3b8l_A163 Uncharacterized protein; putative aromatic ring hy 93.55
3er7_A131 Uncharacterized NTF2-like protein; YP_001812677.1, 93.44
2owp_A129 Hypothetical protein BXE_B1374; cystatin-like fold 93.32
2r4i_A123 Uncharacterized protein; NTF2-like protein, struct 93.09
3blz_A128 NTF2-like protein of unknown function; structural 90.35
3soy_A145 NTF2-like superfamily protein; structural genomics 89.92
3fka_A120 Uncharacterized NTF-2 like protein; structural gen 89.28
3a76_A176 Gamma-hexachlorocyclohexane dehydrochlorinase; bar 88.42
1tp6_A128 Hypothetical protein PA1314; structural genomics, 85.28
3jum_A185 Phenazine biosynthesis protein A/B; chirality, dru 84.24
3ke7_A134 Putative ketosteroid isomerase; structural genomic 83.94
3ef8_A150 Putative scyalone dehydratase; YP_496742.1, struct 81.74
3f14_A112 Uncharacterized NTF2-like protein; YP_680363.1, NT 80.16
>1gy7_A Nuclear transport factor 2; protein transport; 1.6A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1gyb_A Back     alignment and structure
Probab=100.00  E-value=5.1e-35  Score=192.53  Aligned_cols=96  Identities=22%  Similarity=0.510  Sum_probs=90.2

Q ss_pred             CCCCCCCCCceEEEcCCccccHHHHHHHHHcCC--CeeEEEeEEEEEeCCcccccCceeEEEEEEEEEEECCc-eeeeee
Q psy5646           1 MGKLYKDEDAVLSWNGHGTKGSQAIVKYISELP--PCDHELKSMDIHRLPEEAAQNQIAYLISTSGTVVYKNM-KKTGFN   77 (106)
Q Consensus         1 l~~~Y~~~~s~l~~nG~~~~G~~~I~~~l~~lp--~~~h~i~s~D~q~~~~~~~~~~~~ili~V~G~v~~~~~-~~~~F~   77 (106)
                      |++||++ +|.++|+|+.+.|+++|.++|.+||  +++|+|.++||||+..+     ++|+|+|+|.++.+++ ++|+|+
T Consensus        27 L~~~Y~~-~S~~s~~g~~~~G~~~I~~~l~~Lp~~~~~h~i~t~D~qp~~~~-----~gili~V~G~~~~~~~~~~~~F~  100 (125)
T 1gy7_A           27 LGNLYRN-ESMLTFETSQLQGAKDIVEKLVSLPFQKVQHRITTLDAQPASPY-----GDVLVMITGDLLIDEEQNPQRFS  100 (125)
T ss_dssp             GGGGEEE-EEEEEETTEEEESHHHHHHHHHHSCCSCEEEEEEEEEEEESSTT-----SCEEEEEEEEEEETTCSSCEEEE
T ss_pred             HHHhhCC-CcEEEECCcEecCHHHHHHHHHhCCCcceEEEEEEEEEEEecCC-----CeEEEEEEEEEEECCCCCCccEe
Confidence            6789999 9999999999999999999999999  89999999999999642     5899999999999988 899999


Q ss_pred             EEEEEEEeCCeEEEEceeEEeeecC
Q psy5646          78 QNFIISAEGARWKIISDVFRLQQTP  102 (106)
Q Consensus        78 qtFvL~~~~~~y~I~nD~fR~~~~~  102 (106)
                      |||+|+|++++|+|.||+|||++++
T Consensus       101 qtF~L~p~~~~~~I~nD~fr~~~~~  125 (125)
T 1gy7_A          101 QVFHLIPDGNSYYVFNDIFRLNYSA  125 (125)
T ss_dssp             EEEEEEEETTEEEEEEEEEEEECC-
T ss_pred             EEEEEEEeCCEEEEEEEEEEEecCC
Confidence            9999999999999999999999864



>3nv0_B NTF2-related export protein; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} Back     alignment and structure
>1gy6_A Nuclear transport factor 2; 1.6A {Rattus norvegicus} SCOP: d.17.4.2 PDB: 1a2k_A 1oun_A 1ar0_A 1u5o_A 1ask_A 1gy5_A 1jb5_A 1jb4_A 1jb2_A 1qma_A Back     alignment and structure
>1jkg_A P15; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_A Back     alignment and structure
>1zo2_A NTF2, nuclear transport factor 2; structural genomics, structural genomics consortium, SGC, transport protein; 1.60A {Cryptosporidium parvum} SCOP: d.17.4.2 Back     alignment and structure
>3ujm_A Rasputin; NTF2-like fold, RAS signaling, signaling protein; HET: EPE; 2.74A {Drosophila melanogaster} Back     alignment and structure
>3q90_A RAS GTPase-activating protein-binding protein 1; structural genomics, structural genomics consortium, SGC, NT (A+B proteins); 1.70A {Homo sapiens} SCOP: d.17.4.0 Back     alignment and structure
>2qiy_A UBP3-associated protein BRE5; deubiquitylation, ubiquitin-specific processing proteases(UB NTF2, protein-protein recognition; 1.69A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1zx2_A Back     alignment and structure
>1of5_A MRNA export factor MEX67; nuclear protein, repeat, leucine- rich repeat, nuclear transport; 2.8A {Saccharomyces cerevisiae} SCOP: d.17.4.2 Back     alignment and structure
>1jkg_B TAP; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_B 1go5_A Back     alignment and structure
>1q40_B MEX67, mRNA export factor MEX67; NTF2-fold, nuclear export, translation; 1.95A {Candida albicans} SCOP: d.17.4.2 Back     alignment and structure
>1q42_A MTR2, mRNA transport regulator MTR2; NTF2-fold, nuclear export, translation; 1.75A {Candida albicans} SCOP: d.17.4.2 PDB: 1q40_A Back     alignment and structure
>3nv0_A Nuclear RNA export factor 2; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} Back     alignment and structure
>1of5_B MTR2, YKL186C, mRNA transport regulator MTR2; nuclear protein, repeat, leucine- rich repeat, nuclear transport; 2.8A {Saccharomyces cerevisiae} SCOP: d.17.4.2 Back     alignment and structure
>4i4k_A Uncharacterized protein SGCJ; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: CIT PG4 1PE; 1.70A {Streptomyces globisporus} Back     alignment and structure
>3cu3_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; 2.00A {Nostoc punctiforme} SCOP: d.17.4.28 Back     alignment and structure
>3gzr_A Uncharacterized protein with A NTF2-like fold; structural genomics, joint center for struct genomics, JCSG, protein structure initiative; HET: MSE GOL; 1.40A {Caulobacter vibrioides} Back     alignment and structure
>3hx8_A MLR2180 protein, putative ketosteroid isomerase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE UNL PG4; 1.45A {Mesorhizobium loti} Back     alignment and structure
>3d9r_A Ketosteroid isomerase-like protein; YP_049581.1, structural joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.40A {Pectobacterium atrosepticum} SCOP: d.17.4.27 Back     alignment and structure
>3h51_A Putative calcium/calmodulin dependent protein KIN association domain; NP_636218.1; HET: MSE PG4; 1.70A {Xanthomonas campestris PV} Back     alignment and structure
>3rob_A Uncharacterized conserved protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.48A {Planctomyces limnophilus} Back     alignment and structure
>3gwr_A Putative calcium/calmodulin-dependent protein KIN II association domain; YP_315894.1; HET: MSE PG4; 2.01A {Thiobacillus denitrificans atcc 25259} Back     alignment and structure
>2gxf_A Hypothetical protein YYBH; alpha-beta protein., structural genomics, PSI, protein structure initiative; HET: MES; 3.10A {Bacillus subtilis} SCOP: d.17.4.22 Back     alignment and structure
>2ux0_A Calcium-calmodulin dependent protein kinase (CAM II gamma; transferase, oligomerisation DOM serine- threonine kinase, ATP-binding; 2.46A {Homo sapiens} SCOP: d.17.4.7 PDB: 2w2c_A 1hkx_A* Back     alignment and structure
>3bb9_A Putative orphan protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.80A {Shewanella frigidimarina} SCOP: d.17.4.16 Back     alignment and structure
>3b7c_A Uncharacterized protein; NTF-2 like protein, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.70A {Shewanella oneidensis} SCOP: d.17.4.16 Back     alignment and structure
>3duk_A NTF2-like protein of unknown function; structural genomics, joint center for STR genomics, JCSG, protein structure initiative; HET: MSE; 2.20A {Methylobacillus flagellatus KT} SCOP: d.17.4.0 Back     alignment and structure
>2chc_A Protein RV3472; hypothetical protein; 1.69A {Mycobacterium tuberculosis} SCOP: d.17.4.25 Back     alignment and structure
>2rfr_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.16A {Novosphingobium aromaticivorans} SCOP: d.17.4.28 Back     alignment and structure
>3f7s_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; 2.11A {Pseudomonas putida KT2440} Back     alignment and structure
>2rcd_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.32A {Pectobacterium atrosepticum SCRI1043} SCOP: d.17.4.18 Back     alignment and structure
>3cnx_A Uncharacterized protein; putative dehydratase, NTF2-like protein, structural genomics center for structural genomics, JCSG; HET: MSE PGE PG6; 2.10A {Streptomyces avermitilis} SCOP: d.17.4.17 Back     alignment and structure
>3mg1_A OCP, orange carotenoid protein; carotenoid binding protein, echinone, phycobilisome; HET: ECH; 1.65A {Synechocystis SP} PDB: 3mg2_A* 3mg3_A* 1m98_A* Back     alignment and structure
>3b8l_A Uncharacterized protein; putative aromatic ring hydroxylase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.75A {Novosphingobium aromaticivorans} SCOP: d.17.4.28 Back     alignment and structure
>3er7_A Uncharacterized NTF2-like protein; YP_001812677.1, NTF2-like protein of unknown function, struc genomics; HET: MSE; 1.50A {Exiguobacterium sibiricum 255-15} SCOP: d.17.4.24 Back     alignment and structure
>2owp_A Hypothetical protein BXE_B1374; cystatin-like fold, DUF3225 family protein, structural genom joint center for structural genomics, JCSG; 2.00A {Burkholderia xenovorans} SCOP: d.17.4.18 Back     alignment and structure
>2r4i_A Uncharacterized protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG; HET: MSE CIT; 1.60A {Cytophaga hutchinsonii atcc 33406} SCOP: d.17.4.15 Back     alignment and structure
>3blz_A NTF2-like protein of unknown function; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.75A {Shewanella baltica} SCOP: d.17.4.14 Back     alignment and structure
>3soy_A NTF2-like superfamily protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.00A {Salmonella enterica subsp} Back     alignment and structure
>3fka_A Uncharacterized NTF-2 like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.69A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3a76_A Gamma-hexachlorocyclohexane dehydrochlorinase; barrel fold, lyase, detoxification; HET: SPD; 2.25A {Sphingomonas paucimobilis} Back     alignment and structure
>1tp6_A Hypothetical protein PA1314; structural genomics, alpha-beta sandwich, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.12 Back     alignment and structure
>3jum_A Phenazine biosynthesis protein A/B; chirality, drug design, medicinal CH inhibitor, biosynthetic protein; HET: AOD; 1.45A {Burkholderia SP} PDB: 3b4o_A* 3b4p_A* 3dzl_A* 3ex9_A 3cnm_A* 3jun_A* 3juo_A* 3jup_A* 3juq_A* Back     alignment and structure
>3ke7_A Putative ketosteroid isomerase; structural genomics, joint C structural genomics, JCSG, protein structure initiative; HET: MSE BCN; 1.45A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>3ef8_A Putative scyalone dehydratase; YP_496742.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE PG4; 1.50A {Novosphingobium aromaticivorans DSM12444} SCOP: d.17.4.28 Back     alignment and structure
>3f14_A Uncharacterized NTF2-like protein; YP_680363.1, NTF2-like protein of unknown function, structur genomics; HET: MSE TRS PGE; 1.45A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 106
d1jkga_139 d.17.4.2 (A:) NTF2-related export protein 1 (p15) 1e-24
d1gy7a_121 d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {B 4e-18
d1gy6a_125 d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {R 1e-17
d1zo2a1117 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NT 2e-16
d2qiya1139 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {B 2e-12
d1of5b_165 d.17.4.2 (B:) mRNA transport regulator MTR2 {Baker 1e-07
>d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: NTF2-like
domain: NTF2-related export protein 1 (p15)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 88.4 bits (219), Expect = 1e-24
 Identities = 33/103 (32%), Positives = 57/103 (55%), Gaps = 5/103 (4%)

Query: 1   MGKLYKDEDAVLSWNGHGTKGSQAIVKYISELPPCDHELKSMDIHRLPEEAAQNQIAYLI 60
           + +LY    A L WNG+   G +++ ++   LP  + ++  +D   + +EA  +Q   L+
Sbjct: 34  LSRLYMG-TATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLV 92

Query: 61  STSGTVVYKNMKKTGFNQNFIISAEGA----RWKIISDVFRLQ 99
              G+V ++  K+  FNQNFI++A+ +     WKI SD FR Q
Sbjct: 93  VICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQ 135


>d1gy7a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 121 Back     information, alignment and structure
>d1gy6a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 125 Back     information, alignment and structure
>d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]} Length = 117 Back     information, alignment and structure
>d2qiya1 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 139 Back     information, alignment and structure
>d1of5b_ d.17.4.2 (B:) mRNA transport regulator MTR2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 165 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query106
d1jkga_139 NTF2-related export protein 1 (p15) {Human (Homo s 100.0
d1gy6a_125 Nuclear transport factor-2 (NTF2) {Rat (Rattus nor 100.0
d1gy7a_121 Nuclear transport factor-2 (NTF2) {Baker's yeast ( 100.0
d1zo2a1117 Nuclear transport factor-2 (NTF2) {Cryptosporidium 100.0
d2qiya1139 UBP3-associated protein BRE5 {Baker's yeast (Sacch 99.95
d1of5b_165 mRNA transport regulator MTR2 {Baker's yeast (Sacc 99.73
d1q40b_205 NTF2-like domain of mRNA export factor MEX67 {Yeas 99.6
d1of5a_221 NTF2-like domain of mRNA export factor MEX67 {Bake 99.57
d1jkgb_186 NTF2-like domain of Tip associating protein, TAP { 99.48
d1q42a_174 mRNA transport regulator MTR2 {Yeast (Candida albi 99.46
d3b7ca1121 Uncharacterized protein SO0125 {Shewanella oneiden 97.45
d2owpa1128 Hypothetical protein BxeB1374 {Burkholderia xenovo 97.19
d3cu3a1162 Uncharacterized protein NpunR1993 {Nostoc punctifo 96.72
d2gxfa1128 Hypothetical protein YybH {Bacillus subtilis [TaxI 96.71
d2rcda1127 Uncharacterized protein ECA3500 {Pectobacterium at 96.56
d3d9ra1132 Uncharacterized protein ECA1476 {Pectobacterium at 96.41
d1m98a2142 Orange carotenoid protein, C-terminal domain {Cyan 95.96
d3bb9a1121 Uncharacterized protein Sfri1973 {Shewanella frigi 95.89
d2r4ia1122 Uncharacterized protein CHU142 {Cytophaga hutchins 95.58
d2f86b1129 Association domain of calcium/calmodulin-dependent 94.9
d2rgqa1133 Uncharacterized protein NpunR3134 {Nostoc punctifo 94.81
d2chca1167 Uncharacterized protein Rv3472 {Mycobacterium tube 94.15
d2ux0a1135 Association domain of calcium/calmodulin-dependent 94.02
d3cnxa1153 Uncharacterized protein SAV4671 {Streptomyces aver 92.37
d2rfra1153 Uncharacterized protein Saro3722 {Novosphingobium 91.82
d3blza1124 Uncharacterized protein Sbal0622 {Shewanella balti 84.61
d3er7a1118 Uncharacterized protein Exig0174 {Exiguobacterium 84.61
d3en8a1127 Uncharacterized protein BxeB2092 {Burkholderia xen 81.56
d1s5aa_139 Hypothetical protein YesE {Bacillus subtilis [TaxI 80.43
>d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: NTF2-like
domain: NTF2-related export protein 1 (p15)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=5.8e-36  Score=198.65  Aligned_cols=102  Identities=32%  Similarity=0.661  Sum_probs=95.4

Q ss_pred             CCCCCCCCCceEEEcCCccccHHHHHHHHHcCCCeeEEEeEEEEEeCCcccccCceeEEEEEEEEEEECCceeeeeeEEE
Q psy5646           1 MGKLYKDEDAVLSWNGHGTKGSQAIVKYISELPPCDHELKSMDIHRLPEEAAQNQIAYLISTSGTVVYKNMKKTGFNQNF   80 (106)
Q Consensus         1 l~~~Y~~~~s~l~~nG~~~~G~~~I~~~l~~lp~~~h~i~s~D~q~~~~~~~~~~~~ili~V~G~v~~~~~~~~~F~qtF   80 (106)
                      |++||.+ +|.|+|||+++.|+++|.+++++||.++|++.++||||+++...+..++|||+|+|.++.+++++|+|+|+|
T Consensus        34 L~~fY~~-~S~l~~~g~~~~G~~~I~~~l~~lp~~~~~i~~~D~q~~~~~~~~~~~~ilI~V~G~v~~~~~~~r~F~QtF  112 (139)
T d1jkga_          34 LSRLYMG-TATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNF  112 (139)
T ss_dssp             GGGGEEE-EEEEEETTEEEESHHHHHHHHHHSCCEEEEEEEEEEEECCTTTSTTCCEEEEEEEEEEEETTSCCEEEEEEE
T ss_pred             HHHHhCC-CceEEECCeeccCHHHHHHHHHhCCCceeEEEEEEEEEcCcccccCCCeEEEEEEEEEEcCCCCcceeEEEE
Confidence            6789999 999999999999999999999999999999999999999987666667999999999999999999999999


Q ss_pred             EEEEeC----CeEEEEceeEEeeecCC
Q psy5646          81 IISAEG----ARWKIISDVFRLQQTPV  103 (106)
Q Consensus        81 vL~~~~----~~y~I~nD~fR~~~~~~  103 (106)
                      +|+|++    ++|+|.||+|||+|+++
T Consensus       113 ~L~~~~~~~~~~y~I~nD~fR~vd~~~  139 (139)
T d1jkga_         113 ILTAQASPSNTVWKIASDCFRFQDWAS  139 (139)
T ss_dssp             EEEEECCSSSCEEEEEEEEEEETTTTC
T ss_pred             EEEecCCCCCCcEEEEeeEEEEEeccC
Confidence            999974    57999999999999975



>d1gy6a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gy7a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d2qiya1 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1of5b_ d.17.4.2 (B:) mRNA transport regulator MTR2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q40b_ d.17.4.2 (B:) NTF2-like domain of mRNA export factor MEX67 {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1of5a_ d.17.4.2 (A:) NTF2-like domain of mRNA export factor MEX67 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jkgb_ d.17.4.2 (B:) NTF2-like domain of Tip associating protein, TAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q42a_ d.17.4.2 (A:) mRNA transport regulator MTR2 {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d3b7ca1 d.17.4.16 (A:1-121) Uncharacterized protein SO0125 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d2owpa1 d.17.4.18 (A:1-128) Hypothetical protein BxeB1374 {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d3cu3a1 d.17.4.28 (A:9-170) Uncharacterized protein NpunR1993 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2gxfa1 d.17.4.22 (A:1-128) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2rcda1 d.17.4.18 (A:1-127) Uncharacterized protein ECA3500 {Pectobacterium atrosepticum [TaxId: 29471]} Back     information, alignment and structure
>d3d9ra1 d.17.4.27 (A:3-134) Uncharacterized protein ECA1476 {Pectobacterium atrosepticum [TaxId: 29471]} Back     information, alignment and structure
>d1m98a2 d.17.4.6 (A:176-317) Orange carotenoid protein, C-terminal domain {Cyanobacteria (Arthrospira maxima) [TaxId: 129910]} Back     information, alignment and structure
>d3bb9a1 d.17.4.16 (A:27-147) Uncharacterized protein Sfri1973 {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2r4ia1 d.17.4.15 (A:1-122) Uncharacterized protein CHU142 {Cytophaga hutchinsonii [TaxId: 985]} Back     information, alignment and structure
>d2f86b1 d.17.4.7 (B:343-471) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2rgqa1 d.17.4.25 (A:1-133) Uncharacterized protein NpunR3134 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2chca1 d.17.4.25 (A:1-167) Uncharacterized protein Rv3472 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ux0a1 d.17.4.7 (A:387-521) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cnxa1 d.17.4.17 (A:5-157) Uncharacterized protein SAV4671 {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d2rfra1 d.17.4.28 (A:1-153) Uncharacterized protein Saro3722 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure
>d3blza1 d.17.4.14 (A:3-126) Uncharacterized protein Sbal0622 {Shewanella baltica [TaxId: 62322]} Back     information, alignment and structure
>d3er7a1 d.17.4.24 (A:5-122) Uncharacterized protein Exig0174 {Exiguobacterium sibiricum 255-15 [TaxId: 262543]} Back     information, alignment and structure
>d3en8a1 d.17.4.20 (A:1-127) Uncharacterized protein BxeB2092 {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1s5aa_ d.17.4.10 (A:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure